KEGG   Xenopus tropicalis (western clawed frog): 100217324
Entry
100217324         CDS       T01011                                 

Gene name
fgf1
Definition
(RefSeq) fibroblast growth factor 1
  KO
K18496  fibroblast growth factor 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100217324 (fgf1)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100217324 (fgf1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:xtr04052]
    100217324 (fgf1)
   00536 Glycosaminoglycan binding proteins [BR:xtr00536]
    100217324 (fgf1)
Cytokines and growth factors [BR:xtr04052]
 Growth factors
  Growth factors (RTK binding)
   100217324 (fgf1)
Glycosaminoglycan binding proteins [BR:xtr00536]
 Heparan sulfate / Haparin
  Growth factors/receptors
   100217324 (fgf1)
SSDB
Motif
Pfam: FGF Fascin
Other DBs
NCBI-GeneID: 100217324
NCBI-ProteinID: NP_001136293
Xenbase: XB-GENE-485966
UniProt: B7U3X6
LinkDB
Position
3
AA seq 155 aa
MAEGDITTFNPIAESFSLPIGNYKKPKLLYCNNGGYFLRILPDGVVDGTRDRDDLYITLK
LSAQSQGEVHIKSTETGSYLAMDSSGQLYGTLTPNEESLFLETLEENHYNTYKSKKYAEN
NWFVGIKKNGASKKGSRTHYGQKAILFLPLPASPD
NT seq 468 nt   +upstreamnt  +downstreamnt
atggcagagggagacatcacaacattcaaccccattgcagagtccttcagtcttccaatt
ggcaactacaagaaaccaaaacttctgtactgtaataatggagggtattttttgcgcatc
ctcccagatggggttgtggatggaacaagagacagagatgacctttacattacactgaag
ttaagcgcacaaagccaaggggaggtgcatatcaaaagcacagagacagggagttactta
gccatggactccagtggacagttgtatggaactctcacaccaaatgaagaaagcctgttt
ctggagacattagaagagaatcactataacacatacaagtcaaagaagtatgcagaaaat
aactggtttgtggggataaagaagaacggggcaagcaaaaagggatcaaggactcactat
ggacaaaaagccatcctttttctgccgctgccagcatcacctgactag

DBGET integrated database retrieval system