KEGG   Xenopus tropicalis (western clawed frog): 100379853Help
Entry
100379853         CDS       T01011                                 

Gene name
hdac6, hd6, jm21
Definition
(RefSeq) histone deacetylase 6
  KO
K11407  histone deacetylase 6 [EC:3.5.1.98]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xtr01009]
    100379853 (hdac6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:xtr03019]
    100379853 (hdac6)
   04131 Membrane trafficking [BR:xtr04131]
    100379853 (hdac6)
   03036 Chromosome and associated proteins [BR:xtr03036]
    100379853 (hdac6)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.98  histone deacetylase
     100379853 (hdac6)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     100379853 (hdac6)
Messenger RNA biogenesis [BR:xtr03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100379853 (hdac6)
Membrane trafficking [BR:xtr04131]
 Autophagy
  Aggrephagy
   Other aggrephagy associated proteins
    100379853 (hdac6)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HDACs (histone deacetylases)
    Class II HDACs
     100379853 (hdac6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hist_deacetyl zf-UBP
Motif
Other DBs
NCBI-GeneID: 100379853
NCBI-ProteinID: XP_012810564
Xenbase: XB-GENE-5873935
UniProt: A0A1B8XVI4
LinkDB All DBs
Position
Un
AA seq 1445 aa AA seqDB search
MASPQEPKPVAPRGMRGASRSPVTPASNMGKPKKKGASPQGSQSLQEVKKRGHRMRRTPE
KELCDQLEGLNLVAEAAVQGTGLVYDEQMAQTCCLWDENFPECPARIWAVRDKMAEYGLA
ERCVAVQAREASEEEISLIHSPQYVALMGSTQNMNVEELQALSDRYDSVYLHPTSFTCAS
LAVGSVLQLVDKVLRREIRNGLAVVRPPGHHAHVDQMNGYCMFNQLAIAARYAQRTYGAK
RVLIVDWDVHHGQGTQFLFENDPSVLYFSVHRYENGGFWPHLRESASSAVGKERGERFNV
NVAWNKTRMSDADYIHVFLNILLPIAYEFQPHLVLVAAGFDSVVGDPKGEMSATPGCFSH
LTHLLMSLAQGRLILSLEGGYNQRSLAEGVCACLKALLGDPCPKLPLPSAPCQSALDSIS
DTLSAHCRLWKVLQDYESEGEAIDEPQSAEEQPPDGADEPPLEKVLEQSMMEVMREVPAQ
RTALVYDEQMMEHHNMWDSCHPESPQRINQIFKRHKDLGLLDRCSRIPSRLATQKELQMC
HSLSYIQKIEASAHMKPRDLHRLGNEYNSIYINSRSYHSARLAAGSTFSVVEAVVTGKAQ
NGVCIVRPPGHHAEPAEACGFCFFNTVALAARYAQRLRSRSEDPLRVMILDWDVHHGNGT
QHIFQEDASVLYVSLHRYDEGLFFPNSEDASHDKVGIGKGAGFNVNIPWNGSKMGDPEYL
MAFHRVVMPIAYEFNPQLVLISAGFDAARGDPLGGCQVSPEGYAHMTHLLMGLAGGRVIL
VLEGGYNLTSISESMVMCTHSLLGDPPPTLSDLRPPKPSAFNSVRKVRQAHRKYWRSLRL
NVAPQGAHNLQHSPVRNPSQEGRFATEAGPSAMISPQGASPPNRIPSEETAIPLASPQRP
DSVAETPRPLVPESRFSPEEVAGPFTDPLAAPQHVMPTEEVSPQKLTSPKGTSSQLVSNQ
EEPEPTATTESPGIMLHGWQHGTPKSPTSTGTQTELMGAESRADTAPERGATGEKGVTPT
KQELLGEAAGGSEAGNPHIGFETLMESMANESGEGFAVTPLPWCPHLGSVSAVPPAGLDV
RQLCAQCASELENWVCLTCYQVLCGRYVSQHMLCHGLASGHHLVLSFSDLSVWCYGCESY
VHHQALFPAKSAAYSSKFGANSQLECSQEGSAHGTPKSPPSTGSQRVLMGELEAADIAPQ
PEGDPLDVLSPGQRIGSGKEGKAPGPPSSTPGERSLEQILKDLQLSDHAGNNPTIAPANE
THLDPVGGARRKEFISTGRDAREEEQKEGRSIQAKGVTPTKQELLGEAAGGSEAGNPHIG
FETLMESMANESGEGFAVTPLPWCPHLGSVSAVPPAGLDVRQLCAQCASELENWVCLTCY
QVLCGRYVSQHMLCHGLASGHHLVLSFSDLSVWCYGCESYVHHQALFPAKSAAYSSKFGE
EMQSM
NT seq 4338 nt NT seq  +upstreamnt  +downstreamnt
atggcctctccgcaggagcccaaaccagtggccccgaggggcatgagaggagcctcccgc
tctcccgtgactccggcgtccaacatgggaaagcccaagaagaaaggtgcatccccccaa
ggctcccagtccctacaggaagtaaagaagaggggccacaggatgagacgcacccccgag
aaggagctgtgtgaccaactagagggactgaatttggtggcagaggcagccgtgcaggga
acgggactggtttatgatgagcagatggcacaaacctgctgtttatgggatgagaacttc
cctgaatgccctgcccggatctgggcagtgagagacaagatggctgaatacggcctggca
gagcgctgtgtggcagtgcaggcacgagaagcatcagaggaggaaatctcgctcattcac
agcccccagtatgtggctctgatgggatccactcagaacatgaacgtggaggagctgcaa
gctctgtccgaccgctatgattctgtgtacttgcacccgacgtccttcacctgcgcctcc
ttagcagtgggctctgtgctgcagctggtggataaagttctgcgtagggagatccgcaat
ggattggctgttgtcaggccccctggacatcatgcccacgttgaccagatgaacggttac
tgcatgtttaaccagcttgctattgctgcccggtatgcccaacggacatatggtgccaag
cgggtcctaattgtagactgggacgtgcatcatgggcagggcacacagttcctgtttgag
aatgatcccagtgtcctgtatttctctgtccatcgctacgagaacggggggttttggccc
catctgagagaatcggccagttctgctgtgggcaaggagcggggagagagattcaatgtg
aatgtggcctggaacaagaccagaatgagcgacgctgattatatccacgtgttccttaac
atcctcctccctatcgcctacgagttccagcctcacctcgtcttggtagcggcaggattt
gattctgtggtcggagaccctaagggagagatgtcggccaccccagggtgtttctctcac
ctcacccatttgctgatgtcgctggcacagggcaggctcatactttccctagagggtggg
tacaaccagcgctcgttggcagaaggagtttgtgcgtgtctaaaagccttactgggtgac
ccatgcccaaagctgcccctgccctctgctccctgtcaaagcgcactggattccatatca
gacacgctaagtgctcattgcaggttatggaaggtgctgcaggattacgagagtgaagga
gaggccattgatgagccccagagtgctgaagaacaaccccctgacggggcagatgagccg
cctctggaaaaagttctagaacagtcaatgatggaagtgatgagggaggtgccagcgcag
cgaactgctctggtgtatgatgagcaaatgatggagcatcacaatatgtgggacagttgt
cacccagagtctccgcagaggataaaccagatatttaagcggcacaaggacctggggctg
ttggatcgttgcagtcgcatcccgtcgcgcttggccactcagaaggagctacagatgtgc
cacagcctttcctacatccagaagattgaggcatctgcccacatgaaaccccgagacctg
caccgactggggaacgagtacaactccatttatatcaattccagatcctatcacagtgcc
cggctggcagctggctccacctttagtgttgtggaggccgtggttacaggaaaggcacaa
aatggagtttgcattgttcgccccccgggtcaccatgcagaacccgctgaagcctgtggt
ttctgtttctttaacacagtggcactagcggcccgctatgcacagaggctgcggagccgg
tcggaggatccactcagagtaatgattttggattgggatgtgcaccatggcaacggcaca
cagcatatcttccaggaggatgccagtgtgctctacgtgtccctccaccggtatgatgag
ggcctgttcttccctaattcagaagatgcatcacatgacaaggttggcattgggaagggg
gcgggattcaatgtgaacatcccttggaatggcagcaagatgggcgacccggaatattta
atggcgtttcacagagtggtgatgcccattgcctatgagtttaacccgcagctggttctg
atatcggctgggtttgatgcggcccgcggagaccctctggggggctgccaagtgagccct
gaaggttatgcccatatgacgcacctattgatgggcctggcagggggcagagtgattctg
gtgctagagggtgggtacaatctaacatccatctccgagtccatggttatgtgcactcac
tcccttctgggggacccccctcccactctgtctgacctgcgacccccaaaaccgtctgct
ttcaactccgttcgcaaagtccgtcaggctcatcgcaagtactggcgcagccttcggcta
aacgtggccccccagggggcacacaatctccagcactccccagtgaggaacccctcccag
gaaggaagatttgctacggaggctggaccttccgccatgatctccccacaaggggcttca
cctcccaacaggatcccctcagaagagaccgccattcccctggcatcgccacagcgccca
gactccgtggcagagacacctcgcccattggtgccagagagcagattctccccagaggag
gtagccggcccatttacagacccgttggctgcaccccaacacgtgatgccgacagaagag
gtgtcaccccaaaagttgacatcacccaaaggcacaagcagtcagctggtatctaaccag
gaagagcctgagcccacagcaactacagagagccctggcattatgcttcatgggtggcaa
catgggacccccaaatcccctaccagcacaggcacccagacagagcttatgggtgcagag
agtagagctgatactgccccagagaggggagcgaccggagagaagggggtgacccccaca
aagcaggagctgctgggcgaggctgcgggaggctcggaggctggaaacccccacatcggg
tttgagactctcatggagtcgatggcgaacgagtccggtgagggatttgcagtcaccccg
ctgccttggtgcccccacttgggctctgtgagtgctgtgcccccggcgggtctggatgtg
aggcagctgtgtgcccagtgtgccagtgagctggagaactgggtctgtctgacttgttac
caggtgctgtgcggcaggtatgtctcccaacacatgctgtgccatggacttgcctctggg
catcaccttgttctcagcttctccgatctgtctgtgtggtgctacggctgtgagtcctac
gtccatcaccaggccttgttcccggccaaatctgccgcctacagctccaagtttggggca
aacagccagctggaatgtagccaggaagggtctgcccatgggacccccaaatctcctccc
agcacaggcagccagagagtgcttatgggggaattagaggcagcagatattgccccacag
cctgagggtgacccgttagatgttctgtctccggggcagagaattgggtctgggaaggag
ggcaaggcaccggggccccccagttccacccccggggaaagatctttagagcagattctc
aaagacttgcagctgagtgatcatgcaggcaacaatcccaccattgccccggccaatgaa
actcacctggatcctgtgggcggagccagaaggaaagaatttatctctacaggacgagac
gctcgggaggaggagcaaaaggagggcagatctatacaagcaaagggggtgacccccaca
aagcaggagctgctgggcgaggctgcgggaggctcggaggctggaaacccccacatcggg
tttgagactctcatggagtcgatggcgaacgagtccggtgagggatttgcagtcaccccg
ctgccttggtgcccccacttgggctctgtgagtgctgtgcccccggcgggtctggatgtg
aggcagctgtgtgcccagtgtgccagtgagctggagaactgggtctgtctgacttgttac
caggtgctgtgcggcaggtatgtctcccaacacatgctgtgccatggacttgcctctggg
catcaccttgttctcagcttctccgacctgtctgtgtggtgctacggctgtgagtcctac
gtccatcaccaggccttgttcccggccaaatctgctgcctacagctccaagtttggggag
gaaatgcaatcgatgtag

DBGET integrated database retrieval system