KEGG   Xenopus tropicalis (western clawed frog): 100380158Help
Entry
100380158         CDS       T01011                                 

Gene name
slc4a7, nbc2, nbc3, nbcn1, sbc2, slc4a6
Definition
(RefSeq) solute carrier family 4, sodium bicarbonate cotransporter, member 7
  KO
K13858  solute carrier family 4 (sodium bicarbonate cotransporter), member 7
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    100380158 (slc4a7)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100380158 (slc4a7)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   USH complex and associated proteins
    100380158 (slc4a7)
Transporters [BR:xtr02000]
 Solute Carrier Family (SLC)
  SLC4: Bicarbonate transporter
   100380158 (slc4a7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HCO3_cotransp Band_3_cyto
Motif
Other DBs
NCBI-GeneID: 100380158
NCBI-ProteinID: XP_012821001
Xenbase: XB-GENE-963950
LinkDB All DBs
Position
6
AA seq 1149 aa AA seqDB search
MDEDRSGEQMRPLLTTGHDEEAIVDLGKTSSTVNTNFEKEELESHRAVYIGVHVPFARQS
RRRHRHRGHRHHRRRREKENDKEDGRESPNYDTPSQRVQFILGTEDDDEEHIPHDLFTEM
DELCFRDGEECEWKETARWLKFEEDVEDGGDRWSKPYVATLSLHSLFELRSCILNGTIML
DMRANTIEEMSDMLLDNMTASGQMDESMREPVREALLKRHHHQNEKKLSNRIPLVRSFAD
IGKKHSETHLHERNGLLSSPQSVAGNMDTNKTAEMKRNATGGSLENSTVDFSKDPASWHC
SCGTIIMGRKRSAVDMNFMRKIPAGAEASNVLVGEVDFLDRPIIAFVRLCPAVLLSGLTE
VPIPTRFLFILLGPTGKGGQYHEIGRSIATLMTDEIFHDVAYKAKDRNDLLAGIDEFLDQ
VTVLPPGEWDPSIRIEPPKSVPSQEKRKIPTIPNGSTPVGETFKEEQHHTGPELQRTGRV
FGGLMLDIKRKAPFFLSDFKDALNLQCLASVLFLYCACMSPVITFGGLLGEATQNRISAI
ESLFGASLTGIAYSLFAGQPLTILGSTGPVLVFEKILFKFCKDYGLSYLSLRTSIGLWTA
FLCLLLVATDASSLVCYITRFTEEAFAALICIIFIYEALEKLFHLGEKYAFNMHNDLDLL
TKYSCVCSEPLDPNNETLALWSKANITASEVPWDNLTVADCVSLNGTFIGSACGHHGPYI
PDVFFWSVILFFTTFFLSSFLKQFKTKNYFPTKVRSTISDFAVFLTIVIMVLVDFLVGIP
SPKLHVPEKFEPTLKDRGWIIDPLGENPWWTLLAAAIPALLCTILIFMDQQITAVIINRK
EHKLKKGGGYHLDLFMVAIMLGVCSIMGLPWFVAATVLSISHVNSLKVESECSAPGEQPK
FLGIREQRVTGLLIFVLMGLSVFMTSVLKFIPMPVLYGVFLYMGASSLKGIQLFDRIKLF
GMPAKHQPDLIYLRYVPLWKVHVFTVIQLTCLVLLWVIKASSAAVVFPMMVLALVFIRKL
LDFIFTKRELSWLDDLMPESKKKKEDDKKKKAKEEAERMLQAEESDVQIDYEGRNLLQIP
VKNLKYSLDPSVVNISDEMAKTAQWKALSMNPESAKVTRPNLSPDKPVSVKITLEDTSSR
KYVDAETSL
NT seq 3450 nt NT seq  +upstreamnt  +downstreamnt
atggatgaagaccggagtggggaacaaatgagacctctgctcaccacgggacatgatgaa
gaagctattgtggacttggggaagaccagttctacggtaaacaccaattttgagaaggag
gagctggaaagtcacagagctgtttacattggtgttcacgtgccatttgcccgacaaagt
cgtagacgacatagacataggggtcacaggcatcatcgaagaagaagagagaaagagaac
gataaggaggatggaagagaatctcccaattatgacaccccttcccagcgtgtgcagttt
attcttggcactgaagatgatgatgaagagcacattcctcatgaccttttcacagaaatg
gatgaattgtgtttccgggatggtgaggaatgtgaatggaaggaaactgcaaggtggctc
aaatttgaagaagatgtagaagatggcggagacaggtggagcaagccatatgtggcaact
ctttctttgcacagtctgtttgagctaagaagctgcatacttaatggcacaataatgctg
gatatgagagccaacacaattgaagaaatgtcagatatgctgttggataacatgactgcg
tctggtcagatggatgaatccatgagagagccagttcgagaagctctcctaaaaaggcat
caccaccaaaatgagaagaagctaagtaaccgcattccattggtgcgatccttcgctgac
ataggcaagaaacattctgaaactcacttgcatgaacgaaacgggcttctgtcctctcca
cagtctgtagcaggaaatatggatacaaacaaaacagcagagatgaagcggaatgcaaca
ggaggaagtctggagaacagtacagttgatttcagtaaggaccctgcctcctggcactgt
agttgtggcacaataataatgggacgcaagaggtcggctgttgacatgaacttcatgagg
aaaattccagctggagctgaggcatcaaatgtcttagtgggggaagtagattttttggat
cggccaatcattgcatttgtaagattatgtcctgcagttttgctttctggactcacagag
gttccaattcctacacgttttttgtttattttactgggtccaactggaaaaggaggacag
taccatgagatcggaagatcaattgctacccttatgactgatgagatatttcatgacgtt
gcttataaagcaaaggacagaaatgaccttcttgctggaattgatgaatttcttgaccag
gtgactgtcctgcctccaggagagtgggatccatccattcgtattgagcctccaaaaagt
gttccctcccaggaaaaaaggaagataccaaccatcccaaatgggtctactccagtaggt
gaaacatttaaggaagagcaacatcacacaggtccggagctgcaaaggactggaagggtt
tttggtggcttgatgcttgacatcaaaaggaaagcaccttttttcttgagtgacttcaag
gatgcattaaacctgcagtgcctggcctccgttcttttcctatactgtgcctgtatgtct
cctgtaatcacttttggaggtcttctgggagaagcaacacaaaacagaataagtgcaata
gagtctctctttggagcgtcattaacgggaattgcatattctctgtttgctggtcaaccg
cttaccatattgggcagcacggggcctgtccttgtttttgaaaagattctgttcaaattc
tgcaaagattatgggctatcttacttgtccttgcgtacaagtattggtctttggacagcg
ttcttatgtctgttgctggttgcaactgatgcaagcagtttagtgtgctacatcactcga
tttacggaagaagcatttgctgcactcatttgcattatatttatttatgaagctttggag
aaattattccatttaggagagaaatatgcgttcaacatgcacaatgatctagaccttttg
acaaaatattcttgtgtgtgttctgagccactcgaccccaacaatgaaactttagctttg
tggagtaaagctaatatcacagcaagcgaggtaccatgggacaacctcactgtcgctgat
tgtgtgagtttgaatggtacctttattggctctgcctgtggacaccacggcccctatata
ccagatgtttttttctggtccgttattttatttttcacaactttcttcctgtcatctttc
ctgaagcagttcaagactaaaaattactttccaaccaaggtgcgctctactattagtgac
tttgcagtgtttctgacaatagtgattatggttcttgtagactttttggtggggattcct
tctcctaaacttcatgttcctgagaaatttgagcctaccttaaaagacagaggctggata
attgatcctctgggtgaaaacccttggtggacattactagcagcggctattccagccttg
ctttgtacaattcttatcttcatggatcagcagatcactgcagtcattataaaccggaaa
gaacataagctgaagaaaggcggtggataccatcttgatctttttatggttgccattatg
cttggagtgtgttcaattatggggctaccctggtttgttgctgcaactgttctatccatc
agccatgttaacagcttgaaagtggaatctgaatgctctgcccccggagagcagccaaaa
ttcttgggaataagagaacagcgagtaactgggcttctgatctttgttttgatggggctc
tccgttttcatgacatctgttttaaagtttattccaatgccagtcctttatggtgttttc
ctttacatgggtgcttcatcgctcaaaggcattcagctttttgaccgaatcaaattgttt
ggaatgccagccaaacatcagcctgatctaatttacttgcgctatgtacccctctggaag
gttcacgtatttacagttattcagcttacttgccttgtacttctgtgggttattaaagca
tcttcagctgctgttgtgttcccaatgatggtccttgctctggtttttatccgcaagctt
ttggactttatctttaccaaaagagaattgagctggttagatgatctgatgcctgaaagt
aaaaagaagaaagaagatgataagaagaaaaaggcaaaagaagaggccgaaagaatgctc
caggctgaagagagtgatgtacaaattgattatgaaggaaggaaccttcttcagattcca
gtcaagaacttgaaatacagccttgacccctctgttgtaaacatatcagatgaaatggcc
aaaacggctcaatggaaggctctttccatgaatcctgagagtgccaaagtaaccagacct
aacctgagccctgataaacccgtgagtgtgaaaatcaccctagaagacacctcatcccgg
aaatacgtggatgctgaaacttccctatag

DBGET integrated database retrieval system