KEGG   Xenopus tropicalis (western clawed frog): 100485434
Entry
100485434         CDS       T01011                                 

Gene name
tgfa
Definition
(RefSeq) protransforming growth factor alpha
  KO
K08774  transforming growth factor, alpha
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04012  ErbB signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100485434 (tgfa)
   04012 ErbB signaling pathway
    100485434 (tgfa)
SSDB
Motif
Pfam: EGF hEGF
Other DBs
NCBI-GeneID: 100485434
NCBI-ProteinID: XP_002935348
Xenbase: XB-GENE-852694
LinkDB
Position
3
AA seq 160 aa
MYVPSAGESMILLLGFLLAACQALENTTSQLSDPPVAAAVRSHFNDCPVSHSNYCFHGTC
RFIVQEDLPACVCQPGFVGTRCEHADLLAVVAANNKKQTITALVVVSIVATAVLIGTCML
IHCCRIRKQCQWCRAVFCQHEKPGSFLKGGVSCCKSETVV
NT seq 483 nt   +upstreamnt  +downstreamnt
atgtatgtgccctccgccggggaaagcatgatcctgttactgggatttctgttagctgct
tgccaagccctggagaacacaaccagccagctcagtgatcctccagtagcagctgctgta
agatctcactttaatgattgccccgtctctcacagcaattactgcttccatggaacttgc
aggtttatagtgcaagaagatctaccagcctgtgtatgccagcctgggtttgttggtacc
cgctgtgaacatgccgacctcttagcggtggtagccgccaataataagaagcaaacaatc
accgctctggtggtggtgtctattgttgcaacagctgttcttattggaacatgcatgtta
atacactgctgcagaattagaaagcagtgccagtggtgccgggctgtgttctgtcagcat
gagaagcctggcagtttcttaaaaggtggggtttcatgctgcaaatctgagacagtggtc
tga

DBGET integrated database retrieval system