KEGG   Xenopus tropicalis (western clawed frog): 100486082Help
Entry
100486082         CDS       T01011                                 

Gene name
dcc, crc18, crcr1, dcc-a, dcc-b, igdcc1, xdcc
Definition
(RefSeq) DCC netrin 1 receptor
  KO
K06765  deleted in colorectal carcinoma
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB OrthologParalogGFIT
Motif
Pfam: Neogenin_C fn3 I-set Ig_3 Ig_2 ig Pur_ac_phosph_N V-set C2-set_2 Ig_4 DUF2369 Ig_6 Protocadherin EphA2_TM TMEM154 CD34_antigen FAM176
Motif
Other DBs
NCBI-GeneID: 100486082
NCBI-ProteinID: XP_002934493
Xenbase: XB-GENE-852874
LinkDB All DBs
Position
1
AA seq 1428 aa AA seqDB search
MENSLGFYSLPKLVFLLHGFALLSLNLPVSGSQVKSFTSLWFLSEPSDAVTMRGGNVVLN
CSAQSDRGAPLIKWKKDGVYLNLAVDDRRQQLPSGSLLIQNVVHSRHHRPDEGFYQCEAF
LHGVGTIVSRTAKVLVAGPLRILSQTESVTAFVGDTALLKCEIVGEPMPAISWQRNEEDV
KVAPGDTRLLVLPSGTLQISRLQTADGGVYRCLAKNPGSSRVGNEAELRILSESGLHRQQ
VFLQRPANVVAVEGQDAVLECAVSGYPTPTIVWLQGDELVPIRTRKYSVLGGSNLLISNV
TDDDAGTYTCMATYKNENTSFSADLTVMVPPRFLNHPANLYAYESMDIEFECAVSGKPSP
TVKWTKNGEVVIPSDYFQIVGGSNLRILGLVKSDEGYYQCIAENEAGNIQTYAQLIIPDP
AVPSSSVLPSAPRDVVPVLVSSRFVRLSWRPPVEPRGNIQTYTVYFSKQGAQRERAVNTS
QPIALQLTVGNLAPEETYNFRVVAYNEWGPGESSQPVKVGTQPELQVPGPVENLQVVSTA
PTSVLISWEAPAYANGPVQGYRLFCTETFSGREQNIEVDGLLYRLEGLRKFTEYSIRVLA
YNRYGPGVSSEEHAVVTLSDVPSAMPQNVSLEVVNSRNIKVSWLPPPSGTQNGFITGYKI
RHRKTTRRGDLETIEPNNLWYLFTGLEKGSQYSFQVAAMTVNGTGPSSDWYTAETPENDL
DESQVPDQPSSLHVRPLTTSIIMSWTPPLNPNIVVRGYIIGYGVGSPYAETVRVDSKQRY
YSIENLEPSSHYVISLKAFNNAGEGVPLYESATTRSQTVPDMSTPMLPPVGVQAVALTHD
AVRVSWADNSVIKNQKTAEVRFYTIRWRTSYSASSKYKSADTTSLSHTVTGLKPNTMYEF
SVMVTKGRRSSTWSMTAHATTYETAPTSAPKDLTVITRERKPRAVIVSWQPPIEANGKII
DYILFYTLDKNLQIDDWVMVTITGDRLTHEILDLNLDTAYYFRIQARNAKGLGPLSDPIT
FRTPKVEHPDKMANDQGRHGDGGYWSVDTNLIDRSSLNEPPIGQMHPPHGSVTPQKNSNL
LVIIVVTVGAITIVVVVIVAVICTRRSSAQQRKKRATHSAGKRKGSQKDLRPPDLWIHHE
EMEMKNIEKPSGSDTQGRDSPRQSCQDITPVSHSQSESQLGSKSTSHSGPDADEVGSNIS
TLERTLAARRATRAKLMIPMDSQPSSNPPVVSAIPVPTLESAQYPGILPSPTCGYPHPQF
TLRPVPFPTLSMDRGFGSSRAVTEVPASQQSSVLSHPQPEHSSSEDAPSRTIPTACVRPT
HPLRSFANPLLPPPMTAMEPKVPYTPLLSQTGASLPKAQVKTASLGLAGKARSPLLPVSV
PTAPEVSEESHKHTDDPSSVYEQDDLSEQMASLEGLMKQLNAITGSAF
NT seq 4287 nt NT seq  +upstreamnt  +downstreamnt
atggagaatagtcttggattttattcactaccaaagctggtgtttctcctgcatggattc
gctctgctcagcctaaatctcccggtatccggttcacaggtcaagagttttacatcttta
tggttcctgtctgaaccgtcagatgccgttaccatgcgtgggggtaatgttgtactgaac
tgctcggcacaatctgatcggggagctccacttatcaagtggaagaaggatggagtttac
ctgaatctggcagtagatgatagaagacagcagcttcccagtgggtctctcctaatacag
aacgtggtccactcgaggcaccataggccggatgagggtttttatcagtgtgaagctttc
ttacatggagttggaacaatagtcagtcggacagctaaagtactagttgcaggtcccctg
aggatcctctcccagacggaatctgtcacggcgtttgtgggggacacggcgctgttaaag
tgtgaaatcgtgggggagcccatgcccgccatctcatggcagagaaacgaagaggatgtt
aaagtggcgcccggggacacccgcctgctggtgctgccctcggggacgttacagattagc
cgacttcaaacagcagatggcggggtttatagatgtttggcgaaaaatcctggcagctcc
agagtgggaaatgaagccgaactccgcattctgtcagaatcggggttacaccggcagcaa
gtctttctgcagagaccggccaatgtcgtcgctgtcgaagggcaagatgcggtactggaa
tgtgcggtttctgggtatccaacgccaaccatcgtatggctgcaaggagatgaactcgtt
ccaatcaggacaaggaaatactcggtgctgggaggcagcaatctactcatttccaacgtt
accgatgacgacgcggggacgtacacgtgcatggctacctacaagaacgaaaacaccagt
ttctctgccgatctcaccgttatggtgccgccacggtttttaaatcaccctgcaaacctt
tatgcttacgagagcatggatattgagtttgaatgcgctgtttcaggaaagccttcgcct
acagttaaatggaccaaaaatggtgaagtggtcatccccagtgactactttcagattgtg
ggtggcagtaatctaaggattctgggactggtgaagtcagatgagggctattaccaatgt
atagctgaaaacgaggctgggaatatccaaacctatgcacagctcatcatccccgatcct
gctgtccccagttccagcgtcctcccctctgctccccgagatgtggtccctgtcttggtt
tccagccgctttgttcgtcttagctggcggccgcctgtggagcccagagggaacatacag
acgtacacagtatatttctccaagcaaggagcacaaagggaacgggctgtgaatacatcg
caacctatcgcattgcagctcaccgtggggaatctagcgccggaggaaacctacaatttc
cgagtggtggcctataatgaatggggtcctggagaaagttcccaaccggtcaaagttggg
acccagccggagttacaagttccaggacctgtggagaatcttcaggttgtctctactgca
cctacctcagtcttgatttcttgggaagcccctgcttatgcaaatggtcctgtccaagga
tacagattgttttgtacagaaaccttttccgggagagaacagaatatcgaggtggatggg
ctgctatacaggcttgaggggctgaggaagttcacagaatacagtataagggtcttggcc
tataaccgctatgggcctggagtgtcctctgaagaacatgcagttgtcaccctttctgac
gtgcccagtgcgatgccacagaatgtctccttggaagtcgttaactccaggaatataaaa
gtcagctggctgcctcctccatcaggaacacaaaatggattcatcacaggctacaagatt
cggcacagaaagacgacccggaggggggatcttgaaactatagaaccaaacaacctctgg
tatctcttcacaggacttgagaaaggaagccaatacagttttcaagttgccgctatgact
gtaaatggaacgggaccttcctcagattggtatacggcagaaacacccgagaatgatctt
gatgaatcccaggtaccagaccagcccagttcccttcatgtaagaccattaacaaccagc
atcattatgagttggactccaccgctgaaccccaacattgtagtgagaggctacattatc
ggctatggagtcggaagcccatatgcggaaacagtcagggtggacagcaagcagcgatat
tattcaattgaaaatctagagccgagctcccattatgtcatttcactaaaagctttcaat
aacgccggggaaggtgtccctctctatgaaagtgccaccactcgatcacaaacagtccca
gatatgtccacccccatgctcccaccagtaggtgttcaggcggttgcacttacccatgat
gccgtgagagtcagctgggcggacaactctgtcattaagaaccaaaagacagctgaggtg
cgcttttataccatccgctggagaacgagctactcagccagctcaaaatataagtctgct
gatacaacatctctaagtcatacagtaacgggcttgaagccaaacaccatgtatgaattt
tcagtaatggtcacaaaggggagacgctcgagcacttggagtatgacagcccatgccacc
acttatgagacagctccaacatctgccccgaaggacttgacggttatcacaagggaaagg
aagcctcgagctgttattgtgagctggcagcctccaatcgaagccaacggcaaaattatt
gattacatccttttctacaccttggacaagaatctgcagatagatgactgggtgatggtg
acaataactggggacagattgacgcatgaaattctggatctaaacctagacaccgcctac
tactttagaatccaggcacgcaatgccaaaggattggggcctctatcggatccaattaca
tttaggacgcctaaagtggaacaccctgacaaaatggctaatgaccaaggtcgccatgga
gatggagggtactggtcagtcgatacaaacctgatcgacaggagcagcctcaacgaacct
ccgataggacaaatgcaccccccacacggcagcgtcaccccgcagaaaaacagcaacctg
ttggtcattattgtggtgacagtcggcgctattacaattgtggtggtggttatcgtagcg
gtgatttgtacacggagatcttcagcccagcagaggaaaaaacgtgccacgcacagcgct
ggcaagcgaaaaggcagccaaaaagatctgcggccccctgacctttggatccaccatgag
gagatggaaatgaagaacattgaaaagccatctggatcggacacgcaaggaagggactcc
ccaaggcaaagctgtcaggatataactcctgttagccacagtcaatcagaatcacagctg
ggcagcaaaagcacatcgcattctgggccagatgcagatgaggttggaagcaacatatca
acattggagaggactcttgctgcccggcgagccacaagggccaaactcatgattccgatg
gactcacagcccagcagtaaccctcctgttgtgagtgccattcccgtgccaaccctggaa
agcgctcagtaccctggcatccttccgtcaccaacatgtggctacccacacccgcagttt
actctaaggccggtacctttccctacactttccatggacaggggatttggatcttctcga
gcagtgaccgaggtccccgcttcccagcagtcatcagtgctgtcacacccacagccagaa
cattcctcaagtgaagacgccccaagcagaacaatccccactgcctgtgttcggccaacg
caccctctccggagttttgcaaacccgttgttaccgccaccaatgactgcaatggaaccc
aaagttccttacacaccgctcttgtctcaaacaggggcaagcctccctaaggcgcaagta
aagacagcctcattggggctggccggtaaagccaggtctccgctgctccctgtatccgtg
ccgacagcgccagaggtttcggaggaaagccacaaacacacagatgacccttccagtgta
tatgaacaggatgatttaagtgaacaaatggccagtttggagggtttgatgaagcagctc
aatgccatcacgggatcagctttttaa

DBGET integrated database retrieval system