KEGG   Xenopus tropicalis (western clawed frog): 100486462Help
Entry
100486462         CDS       T01011                                 

Definition
(RefSeq) solute carrier family 40 member 1-like
  KO
K14685  solute carrier family 40 (iron-regulated transporter), member 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04216  Ferroptosis
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    100486462
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100486462
Transporters [BR:xtr02000]
 Solute carrier family (SLC)
  SLC40: Basolateral iron transporter
   100486462
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FPN1 MFS_1 DUF3185 Phage_holin_5_2
Motif
Other DBs
NCBI-GeneID: 100486462
NCBI-ProteinID: XP_017950318
LinkDB All DBs
Position
6
AA seq 273 aa AA seqDB search
MLRICTDGWKSYYRQSVFLAGLGLAFLYTTVLGFDCITTGYAYTQGISGSLLSLLMAVSA
ISGLMGTFLFTRLRRHYGLMVTGIISSCLHVCCLMLCVFSVFAPGSPFDLGIFSVLMGVN
SSINMGELEQSQVHLYPPHRNMNQPILPDRSSIHWTNNTVLLENIHTGDHPDSYISIILL
FLGVILARIGLWSFDLTVTQLLQENIPESERGVVNGVQSSMNYLMDLVHFIMVILAPQPQ
QFGLLVIISTLFVIAGHTMYFSYTRKYKAMEKE
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgttgcgtatctgcacagatggctggaaatcctactacagacagtcggttttcttggcg
ggtttgggactggcatttctgtacacaacagtcctaggctttgactgtatcactacaggt
tatgcctatactcaggggatcagtggctccttactcagccttctcatggcagtatcagct
atctcaggattaatgggcacatttctgtttacaaggctaaggagacattatggcttaatg
gtcacaggaattatttctagctgcctccatgtctgttgcttaatgctttgtgtattttca
gtctttgctcctggaagtccctttgacttgggcattttttctgttcttatgggtgtaaac
tcctctataaacatgggtgagctagaacagagccaggtgcatttgtatcccccacatagg
aatatgaaccaacccatcctcccagatcgctcttctatacactggaccaacaacactgtt
ctgctggagaatatacatactggagaccatcccgattcctatatctccatcattttgctg
ttcttaggagtaatactagcaagaattggcctttggtcttttgatctgacagtgacccag
cttcttcaggagaatatacctgaatcagaacgtggtgttgtaaatggggttcagagctca
atgaattatctgatggatcttgttcatttcattatggtcattttagctccacaacctcag
cagtttggacttctcgttataatctctacgctctttgtaattgccggacacaccatgtat
ttttcttacaccagaaaatacaaagcaatggagaaggaatag

DBGET integrated database retrieval system