KEGG   Xenopus tropicalis (western clawed frog): 100486579Help
Entry
100486579         CDS       T01011                                 

Gene name
slc26a11
Definition
(RefSeq) solute carrier family 26 (anion exchanger), member 11
  KO
K14708  solute carrier family 26 (sodium-independent sulfate anion transporter), member 11
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100486579 (slc26a11)
Transporters [BR:xtr02000]
 Solute Carrier Family (SLC)
  SLC26: Multifunctional anion exchanger
   100486579 (slc26a11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sulfate_transp STAS STAS_2
Motif
Other DBs
NCBI-GeneID: 100486579
NCBI-ProteinID: XP_002937354
Xenbase: XB-GENE-955145
LinkDB All DBs
Position
10
AA seq 594 aa AA seqDB search
MECLEGESCGRRLHPTLTCCFSCNSLQKRLPFLQWLPRYSLQWLQLDIIAGITVGLTVVP
QALAYAEVAGLPVQFGLYSSFVGCFIYCFLGTSKDVTLGPTAIMSLLVFVYTLGDLSLAI
LLTFISGCIQLAMGLLNFGFLLDFISYPVIKAFTSAAAITIAFSQVKNLLGLQDIPRQFI
LQVYQTFRKLPSTRPGDAILGILCIAILLALKWMKDHTSRPYQGMSICHRICYLIVWIMT
TARNALIVVGAGLVAYSFHVMGLHPFILTGKTAKGLPQFQLPPFSEITPNGTKTFSEMVQ
VIGSGILIIPLMGLLESVAIARAFASQNNYRIKTNQELLAIGLTNILGSFLSSYPVTGSF
GRTALNSQTGVCTPAGGIITGLLVLLSLGYLTPAFYFIPKAALAAVIICAVAPMFDLRIC
KSMWKVKRLDLIPFFVTFLLSFWEIQYGILAGTFVSIIFLCYPIARPEIKVSDMDGLILT
PMSGLSFPAMEYLKDKIYEKTFTVSSPQSVTLDFTHVTAIDYTVVVGLAELLSEFKAQGV
CLTFSGLQPPLLHMFSSSGLTELHHFHSIETSGGSFQEDESTQPLLRNGIVSLP
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atggagtgcttggagggcgagtcatgtggcaggaggctgcatcctaccttgacctgttgc
ttctcctgtaatagtttgcaaaagaggttgccatttcttcaatggcttccacgatattca
ctgcaatggctgcagctggacatcattgctggcattactgtgggactgactgtggtaccc
caggctctggcctatgcagaagttgctgggctgcctgtgcaatttggactctattcctca
tttgttgggtgtttcatttattgcttccttgggacgtctaaagatgttacacttggtcca
actgctatcatgtccctgcttgtatttgtgtatacactgggggacctttccttggccatt
ctgttgacgttcatctcaggctgcatccaactggctatgggtctcttaaattttggtttc
cttttggatttcatttcatatccagtcatcaaggcttttacttcagcagcagctatcaca
attgcttttagccaagttaagaacctgcttggtttgcaagatatccctcgtcagtttatt
ttacaagtttatcagacattccgcaagcttccaagtacaagacccggagatgcaatcctg
ggaattctttgcattgccattctcctggcactaaagtggatgaaggaccatacttctagg
ccttaccaaggcatgtcgatttgccaccgaatctgctacctcattgtttggattatgaca
acagctcgcaatgcacttatagtggttggtgcaggactggtggcttattcctttcatgtc
atgggactccatccttttatcctaactgggaagacagcaaagggacttccccagttccag
ctgccacccttttctgagatcactcccaatggcacaaagactttcagtgagatggttcag
gtgattggatctgggattttaatcatacctcttatgggactgctggagagcgtggccatc
gcccgagcttttgcatctcagaataattatcggatcaaaaccaaccaggagctgttggct
ataggcttaaccaacatccttggctcgtttctgtcttcatatccagtgactggaagcttt
gggagaactgctcttaattcccagacaggagtgtgtacgcctgcgggtggaataattact
gggctgctggtcttactctcccttggatacctcacccccgccttctacttcatccctaaa
gctgctcttgccgctgtcattatctgcgctgtggcacccatgtttgatctgagaatatgc
aaatccatgtggaaagtaaaaagacttgacctgataccgttctttgtcaccttcttgcta
tccttctgggagattcagtatggaatccttgctggaacgtttgtttcaattatttttctg
tgttatcctattgcacgaccagagattaaggtttctgacatggatggcttaatcttgaca
ccaatgagtggcctgagttttccagctatggaatacctcaaagacaaaatttatgaaaag
acgtttacagtgtcttcaccccagtcagtgacgctggattttactcatgtgactgcaatc
gattatacagttgtcgtagggctggctgaacttctttccgagtttaaggcacagggggtg
tgcctaactttctcagggttacagcctcctctacttcatatgtttagttcatctggtttg
acggagttacatcattttcacagtattgaaacatcaggaggctcatttcaagaagatgaa
agcacacaacctttgcttcgcaatggtattgtgtctttaccgtag

DBGET integrated database retrieval system