KEGG   Xenopus tropicalis (western clawed frog): 100487033Help
Entry
100487033         CDS       T01011                                 

Gene name
slc19a1, RFC, XRFC, chmd, folt, ifc1, refc, rfc1
Definition
(RefSeq) solute carrier family 19 (folate transporter), member 1
  KO
K14609  solute carrier family 19 (folate transporter), member 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100487033 (slc19a1)
Transporters [BR:xtr02000]
 Solute Carrier Family (SLC)
  SLC19: Folate/thiamine transporter
   100487033 (slc19a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Folate_carrier MFS_1 Phage_holin_3_6
Motif
Other DBs
NCBI-GeneID: 100487033
NCBI-ProteinID: XP_002932056
Xenbase: XB-GENE-949159
UniProt: F7EDM0
LinkDB All DBs
Position
9
AA seq 538 aa AA seqDB search
MAQNKSDAQAPEESFTVHGIQMASENGEMKGQQTPNEEQQSPNEEQQFLPVELQSPTVKL
PSPLEGVETLPEEYKQWKFLLFYLCIYGFMTQLRPGESFITPYLLSPERNFTKEQVTNEI
TPVLSYSYMAVLVPVFLLTDYLRYKPVLILQSLSHISVWLLLIFGTDVIAMQFMEFFYGI
TMAARVAYSSYIFSLVSPTNYQRAAGYSRSSVLMGVFTSAVLGQLCISLAGVPFKTLNYI
SLGFMALGLILTLFLKRPERSLFFNKSISKQENGIHLSEEQKAIPGAKTGGFCSGCRNFV
IIRMLMELKGTVRNPRLRLWSLWWIFNSAGYYLMLYYVQILWNTIYPTIDNRKVYNGGVD
AASTLLGAITSFAAGHIKIRWNLWSELVIGLVTAFQAGLLILMNTTENIWVCYVAYVLFR
SSYQFLVPIAIFQIASNLSKELCALVFGVNTFFATILKTIITIIIADKRGLALSVHPQFY
VYFAYFTVLAVLYLGAAAFVIIRHYHAERLKEKPQVLPKPETEQTTTSNNAATCESRA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atggcacagaataagagcgacgcgcaagctccagaggagagctttaccgttcatggtata
cagatggcttcagagaatggggaaatgaaggggcagcaaacccctaatgaggaacagcag
tctcccaatgaagaacagcaatttctccccgtggagcttcagtcacctacagtcaagctg
ccttctcctttagagggtgtggagaccctgccagaggagtacaagcagtggaagttcctg
ctcttctacctttgtatatatggcttcatgactcagctgcgtcctggagaaagctttata
acgccatacttactgagcccagagaggaatttcacaaaagagcaggttaccaatgagatc
acgccagtgctgagctactcctacatggctgttcttgtgccagtctttctgctcactgac
tatttgcgatacaagcctgtgctgattctgcagagtttaagtcacatctcagtgtggctg
ctgctcatctttggcacagatgtaattgccatgcaatttatggaattcttctatggtatc
acaatggcagctcgggtcgcttattcctcttacattttctctctggtgtcaccgacgaat
tatcagcgggcggcagggtactcccgttcctcagtacttatgggtgtctttacaagtgct
gtacttgggcagctgtgcatcagcttggctggtgtgcctttcaaaacccttaattacata
tccttgggctttatggcacttgggctcatccttaccttatttctaaaaaggcccgagaga
agtcttttcttcaataaaagcatttctaagcaggagaatggcattcacctctctgaggag
caaaaagcaatccctggagctaaaactgggggtttctgctctggatgcagaaactttgtt
attatacgcatgctgatggaactcaaaggaactgtacgtaacccccgacttcgtctatgg
tctctatggtggatatttaactctgctggctattacctaatgctatattatgtacagatt
ttgtggaacacgatctaccctaccattgataatagaaaagtgtacaatggtggtgttgat
gcagcatccacgctccttggagccatcacatcctttgctgcaggacatataaagatcaga
tggaatctgtggtcagaattggtcattgggctggtcactgctttccaggctgggcttctt
attcttatgaacacaacagaaaatatctgggtttgctatgtagcctacgttctttttaga
agttcgtaccagttcctggttcccattgccatcttccagattgcaagtaacttgtccaaa
gagctttgtgctttagtgtttggtgttaacacattctttgccaccattctgaaaaccata
attactattatcatcgctgataagagaggtctggctctttctgtacaccctcagttttat
gtctactttgcatactttaccgtgttggcggtgctgtacctgggggctgctgcctttgtc
attatcaggcattatcatgcagaacgactgaaagagaaacctcaagtacttccaaagcct
gaaaccgagcagacaactacatccaacaatgcagccacatgtgaatcccgtgcctaa

DBGET integrated database retrieval system