KEGG   Xenopus tropicalis (western clawed frog): 100487465Help
Entry
100487465         CDS       T01011                                 

Gene name
tgm1
Definition
(RefSeq) transglutaminase 1
  KO
K05619  transglutaminase 1 [EC:2.3.2.13]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    100487465 (tgm1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100487465 (tgm1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_C Transglut_N Transglut_core
Motif
Other DBs
NCBI-GeneID: 100487465
NCBI-ProteinID: XP_002939073
Xenbase: XB-GENE-1013422
LinkDB All DBs
Position
1
AA seq 788 aa AA seqDB search
MARCEERKKSFWERLCPCCCTERSQYEPDNDMRPVNRPDGGSRDNRPDGGIGDNRPDGGS
RDNRPDGGSRDNRPDGGSRDNRPDGGSRDNRPDGGSRDNRPSVNPPSPSLTPSIGGPLQV
QNVDLLKQRGGETRRAHHTDEFEYDELIVRRGQPFKICVTFQRAFNPKSDRICVVLQMAN
AQPITLSQVNEFDESGWACQVAEVNGCKSNIWLNTSAQAPIGLYQMIVKTNSGEGPSNLR
VYILFNAWCRMDSVFMDNEAWRQEYVLNEIGRIYYGTQNQIGERSWNYGQFDKGVLDACL
YLLDCGRIAPGSRGDPINVTRVISAMVNSMDDNGVVAGSWSGDYADGVNPVAWVGSVDIL
LRYHQSGSSVKYGQCWVFGGVTTTVLRCLGIPGRTITNFASAHDADGNLTFDIYFDENMK
PIEDKNRDSVWNYHVWNDCWMTRPDLPAGYSGWQAIDSTPQETSNGIYCCGPCPLLAIKN
GLTNIKYDAPFIFAEVNSDKVCHQRMPNGQFKRVLVEERAVGHCISTKAVGSFARDDITY
LYKHPEGSTEERNSVHTAARYSNKPLAAVDNEETSDVSMSVESQDGVITGSDINVRVLLK
NNSNSRRCVSLSLTVGVMYYNGICKESFKNETRDTTLNPGEGKAVGMLISYAEYSKHLVD
QGAMMLTVSGIVNETGQKLAKQHTFRTRTPDLVIKVRGDAIVGQQIVAEVIFKNPLNTTL
HNAVFHVEGPGLQRPKVIKYGNIGPLQTVCVSERFTPRRPGPRQFIASLESNELSQVHGT
TEVVVQPC
NT seq 2367 nt NT seq  +upstreamnt  +downstreamnt
atggctcggtgtgaggagaggaaaaagtccttctgggagaggctctgtccatgttgctgc
acagagagaagccaatatgagccagacaatgatatgagaccagtaaacagacctgatgga
ggaagcagggacaacagacctgatggaggaatcggggacaacagacctgatggaggaagc
agggacaacagacctgatggaggaagcagggacaacagacctgatggaggaagcagggac
aacagacctgatggaggaagcagggacaacagacctgatggaggaagcagggacaacaga
ccttcagttaaccctccctctccttcccttaccccttccataggaggaccactgcaggtg
caaaatgtggacctgttgaaacagcgtggaggagaaacacgcagagctcaccatacagat
gaatttgaatatgatgagctcattgtgcggagagggcagccctttaaaatttgtgtcact
ttccagagagcattcaaccctaagagcgatcggatttgtgttgtactacaaatggcaaat
gctcagccaatcaccctttcacaagtcaatgaatttgatgaaagtggttgggcatgtcaa
gtagctgaggtcaatggttgcaaatcgaatatatggttgaacacatcagctcaggctcca
ataggactttaccaaatgattgtgaagactaacagcggggaaggaccctccaatctcagg
gtctatatcctcttcaacgcttggtgccggatggattcagtctttatggataatgaagca
tggcggcaggagtacgtgcttaatgagattggcaggatatattatggcactcaaaatcag
attggagaacgatcctggaactatgggcagtttgataaaggagtccttgatgcttgcctc
tatctgttagactgtggtcgtatagcacctggttcacgaggagatccgataaatgtcacc
cgagtcatatctgcgatggtaaattcaatggatgacaatggtgtggttgcaggaagctgg
tctggggattatgcagatggcgtaaatcccgttgcgtgggttggaagtgtggatatttta
ctccgatatcaccagagtggcagctcagttaaatatggacagtgctgggtgtttggtggt
gtcacaactacagtattacgatgtcttggaattcctgggcgaaccattaccaattttgca
tctgcgcatgatgctgatggaaacctcacatttgatatttattttgatgaaaatatgaag
cccatcgaagataagaaccgtgactcagtctggaattaccacgtttggaatgactgctgg
atgacacgcccagatcttcctgcaggatatagtggttggcaggcaattgattctacccct
caggaaaccagcaatggtatttactgctgtggtccttgccctcttcttgctattaagaat
ggactgaccaatataaaatatgatgcaccattcatctttgcagaggtaaattcagacaag
gtctgccaccagcgtatgccaaatggccaatttaagcgggttcttgtggaggagagagca
gttggccactgcatcagtaccaaggcagttggctcttttgcccgagatgacatcacttac
ctgtacaagcacccagaaggatcaaccgaagagcgtaactcagtgcacactgctgcacgt
tattcaaacaaaccactggcagctgttgataatgaagagacaagtgatgtgtccatgtcg
gttgagtcacaggatggtgtcatcacaggaagtgacatcaatgtcagagtgttactgaaa
aataacagcaatagtcgacgctgtgtgtccttgtccttgaccgttggtgtcatgtactac
aatggaatttgcaaagaatcattcaaaaatgagacccgagatacaacactaaatcctgga
gaaggaaaggcagtcgggatgctgattagctatgcagagtacagtaagcatttagtggat
cagggtgccatgatgctcactgtgtctggaatagtaaatgagacgggtcagaaacttgcc
aaacagcacacatttagaacaaggactccagatctggtcatcaaggtccggggcgatgct
atagttggccaacagatagtggcagaggttatattcaagaacccacttaacacaactctg
cacaatgctgttttccatgtggaagggcctggcctgcagaggccaaaggttataaaatac
ggtaatattgggcccctccaaactgtatgcgtctcagagcgtttcacacctagacgtccc
ggtcctcgtcaatttattgccagtctggagagtaacgaattgagccaagtacatggaacg
acagaagtggtcgtgcaaccctgctaa

DBGET integrated database retrieval system