KEGG   Xenopus tropicalis (western clawed frog): 100487507Help
Entry
100487507         CDS       T01011                                 

Gene name
slc46a2
Definition
(RefSeq) solute carrier family 46 member 2
  KO
K14614  MFS transporter, PCFT/HCP family, solute carrier family 46 (thymic stromal cotransporter), member 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100487507 (slc46a2)
Transporters [BR:xtr02000]
 Solute Carrier Family (SLC)
  SLC46: Folate transporter
   100487507 (slc46a2)
 Major Facilitator Superfamily (MFS)
  Organic acid transporters
   Proton coupled folate transporter/heme carrier protein (PCFT/HCP) family [TC:2.A.1.50]
    100487507 (slc46a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 100487507
NCBI-ProteinID: XP_017953045
Xenbase: XB-GENE-988711
LinkDB All DBs
Position
1
AA seq 444 aa AA seqDB search
MSRTWIEPVVAGAQIASSFYDTGLLLVVKSHYNQSSLSSNSTSDDEEQNAISNFYLIHNL
ILALTPILSAYILANIGDKKSRKVPICVPLLGYFVSRMFLLFVILFNWPIEVMFGSAALN
GLTGFFTTYWAGVLAVASLGSSESKRSVRIIIIELVYGVAGFVGSLVSGHIFKNFDIANQ
KGSVLVILSLCFYAFSLIYSLFIFKIPRIEETGPGNTESTETSTLLMKNPTETSTANGVT
MTSSSKVFLVLLFLSAILYNAAVGGAVDVLPFFIIKEPLSWGAVEVGYANAAGYLIFVTS
FLGVYFFSKRLTDFVMIGIGILSFSAGIFIMGFVQWTFLFYVARVVMMFSLIPLPTIRSV
ISKHVQGSSYGKVFVVLQLLLSITHVVTLISFTKLYQASLKWFHGLCFILASIIALLSLI
PIRIAAYMHQSRTTIMSSATHTIS
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagaacctggattgaaccagtggtggctggggcccagatagctagctcattttat
gacactgggctgcttttagtggtgaagagccactacaaccaatcatctttatcttcgaac
agcaccagtgatgatgaagagcagaatgccatctctaacttttacctaatccacaatttg
atcttggcactgaccccaattctttctgcctatatactggccaacataggtgataaaaag
agcagaaaggtcccgatatgtgtgccgctacttggctactttgtatcacggatgtttctt
ctctttgtgattctatttaattggcccatagaggtcatgtttggctctgctgctctgaat
ggcttgactggattttttaccacatactgggctggagttttggcagttgcatctctgggc
tcttctgagagcaaaagatcagttcgaattattatcattgaactggtctatggagtggct
ggttttgtaggcagtttggtatctggccatatattcaagaattttgatattgcaaaccag
aaaggttctgtcctggtaatcctcagtctttgcttttatgccttctcccttatttatagt
ctttttatttttaaaatccctagaattgaagaaactgggcctggcaacacagaatcaaca
gaaacatccacactgctaatgaaaaatccaactgagacatcaacagcaaatggtgtaacc
atgacttcttcttctaaggtcttccttgttttactcttccttagtgccatcttgtataat
gcagcagtaggtggtgctgtggatgtgcttcccttctttatcattaaagaacccctaagc
tggggtgccgtagaagttggttatgctaacgccgctggctacctaatatttgtaacaagc
tttttgggagtatattttttctccaaacgtttaacggattttgtcatgattggcattggc
atattgtccttcagtgctggtatattcatcatgggatttgtacaatggaccttcttgttt
tatgttgctcgagttgtgatgatgttttcattgataccactgccaacgattagatctgta
atatccaaacatgtacaaggatcatcctatggtaaagtctttgttgtgctgcagctttta
ttatctatcacacatgtggtaactttaatttcattcaccaagctttaccaagcctcactg
aaatggtttcatggactctgctttatcctggcaagcataattgctctgctcagcctcatt
cccatcagaattgcagcgtatatgcatcagtcaaggactaccattatgagcagtgcaaca
catacaatttcctag

DBGET integrated database retrieval system