KEGG   Xenopus tropicalis (western clawed frog): 100487834Help
Entry
100487834         CDS       T01011                                 

Definition
(RefSeq) aquaporin-4-like
  KO
K09866  aquaporin-4
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100487834
Transporters [BR:xtr02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaporins
    100487834
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP DUF1082
Motif
Other DBs
NCBI-GeneID: 100487834
NCBI-ProteinID: XP_017950427
LinkDB All DBs
Position
6
AA seq 299 aa AA seqDB search
MVAFKGVWTQPFWRSVSGEFIAMLIFVLLGLGSTISWGVGDSPQPADLLRISLCFGLSIV
TMVHCFGHISGAHLNPAVTIAFVCTRRITLAKSLFYIIAQCLGAISGAGLLYIITPFNLI
GNLGVTMVNERLSLGHGLLVEILITFQLVFCISASCDPKYKDKYPPIAIGISVIIGHLFA
INYTGASMNPARSLGPAVILWNWKSHWIYWVGPIIGAVCAATVYDYIYCPDNDLKQHLKE
AITKATQKTKGKYIEVDDCRSQADAEDLILKSGTVHVIDIDQAESKKGKDSASEILSTV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggtagcatttaagggagtttggacccaaccattttggagatctgtctctggtgaattt
atagccatgcttatttttgttcttcttggacttggttcaacgatcagctggggggtaggg
gacagccctcagcctgcagatcttttacgcatttcactttgttttggcttaagcattgtc
acaatggtgcattgttttggacacatcagtggtgcccatcttaatccagctgtcactatt
gcatttgtgtgcaccagaagaattactcttgccaaatcattattctacatcatagcacaa
tgcctgggagccatctcaggggcaggacttctatacataattacacctttcaatttgatt
ggaaacttaggagtgacaatggttaatgaaagactatcacttggtcatggacttcttgta
gaaattttaattacattccagctggtattttgcattagcgcaagttgtgatccaaaatac
aaagacaaataccctcctatagcaattggcatttcagttataataggacacctgtttgca
ataaactacacaggagccagcatgaaccctgcaagatctctcggacctgctgttattctc
tggaactggaaaagtcactggatttattgggttggaccaatcattggagcagtctgtgct
gcaactgtttatgactatatctattgtccggacaatgatctcaaacaacatttaaaagaa
gcaattacaaaggcaacacagaagacgaaaggaaaatatatagaggttgacgattgcaga
agccaagctgatgctgaagatttaatcttaaaatcgggaacagttcatgtaattgatatc
gaccaggccgagagcaaaaaaggcaaagactcagctagtgaaatattatctacggtgtaa

DBGET integrated database retrieval system