KEGG   Xenopus tropicalis (western clawed frog): 100488514
Entry
100488514         CDS       T01011                                 

Gene name
cacna1e
Definition
(RefSeq) voltage-dependent R-type calcium channel subunit alpha-1E isoform X2
  KO
K04852  voltage-dependent calcium channel R type alpha-1E
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04020  Calcium signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100488514 (cacna1e)
   04020 Calcium signaling pathway
    100488514 (cacna1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:xtr04040]
    100488514 (cacna1e)
Ion channels [BR:xtr04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   100488514 (cacna1e)
SSDB
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel
Other DBs
NCBI-GeneID: 100488514
NCBI-ProteinID: XP_017949086
Xenbase: XB-GENE-1012852
LinkDB
Position
4
AA seq 2393 aa
MVLKMLGLSSCSTSAHTLNEPDQSSTLAIPALDADTQRYVLALPEAETWRKHRLGLTQAT
HSCNLLEPETLSETLVSRTASYDALYDLRAREAESNFPFEGSSMFEVTSGMDSEFPLSPH
VIKRRRGGLIEQKDIIKAHEAHKIQSTPQARRKEWEMARFGEAVTGRLSSADGGSERSKT
LQGSPAAPVGTQAAFKQSKAQRARTMALYNPIPVRQNCFTVNRSLFIFGEDNIIRKYAKK
LIDWPPFEYMILATIIANCIVLALEQHLPGDDKTPMSRRLEKTEPYFIGIFCFEAGIKIV
ALGLVFHKGSYLRNGWNVMDFIVVLSGILATAGTHFNTHVDLRTLRAVRVLRPLKLVSGI
PSLQIVLKSIMKAMVPLLQIGLLLFFAILMFAIIGLEFYSGKLHKACYRNNSGMELDPMD
PPHPCGVPRCPAGYECKEWIGPNDGITQFDNILFAVLTVFQCITMEGWTTVLYNTNDALG
ATWNWLYFIPLIIIGSFFVLNLVLGVLSGEFAKERERVENRRAFMKLRRQQQIERELNGY
RAWIDKAEEVMLAEENKNSGTSALEVLRRATIKRSRTEAMNRDSTEDHCVDISSVGTPLA
RASIKSTKMDGASYFRHKEKLLRVSVRHMIKSQVFYWMVLGVVALNTFCVAIVHHNQTLW
LSNVLYYAEFLFLGLFLVEMAFKMYGMGPRLYFHSSFNCFDCGVTIGSIFEVLWAIFRPG
TSFGISVLRALRLLRIFKITKYWASLRNLVVSLMNSMKSIISLLFLLFLFIVVFALLGMQ
LYGGRFNFNDGTPSANFDTFPAAIMTVFQILTGEDWNEVMYNGIRSQGGVRSGMWSSIYF
IVLTLFGNYTLLNVFLAIAVDNLANAQELTKDEQEEEEAFNQKHALQKAKEVSPMSAPNA
SCIEKERRKRHTLSIWEQRTSQLRRHIQMSSQEALQSEELAALNPHSSIYRKTKEAAEQN
TEKEEVHQDAKLAIDPVEGPPEGEGSPSNRNLRENWRQKSRHGNSENTEPNGTTPEEAMR
RRQSQRRSRHRRVRTEGREQCSNPNSTSASREGGLDKVSAEDGRTIPEEKSNGEAKEVKG
VDDEPLKICISSRNCEDRNIRTLGCEGIALNDTPLQDVNSQEKDSSPPDLDCSEQALLGS
IQSQESPNPTSCSLPDVSSSTERVTESTVITLPDTGMPTDCTVVQMSEGRDGEVNFGSSQ
QEKEEEEAEDGEERTIKRKEKLLESPKAIVPYSSMLIFSSTNPIRKVCHYIVNLRYFEMS
ILLVIAASSIALAAEDPVLTNSDRNKVLRYFDYVFTGVFTFEMIIKMIDQGLILHEGSYF
RDLWNILDFVVVVGALIAFALANVLGTNKGRDIKTIKSLRVLRVLRPLKTIKRLPKLKAV
FDCVVNSLKNVFNILIVYKLFMFIFAVIAVQLFKGKFFYCTDSSKETEKECIGSYIDHEK
NKMEVKRREWKRHDFHYDNIIWALLTLFTVSTGEGWPQVLQHSVDITEEDRGPSRSNRME
MSIFYVIYFVVFPFFFVNIFVALIIITFQEQGDKMMEECSLEKNERACIDFAISAKPLTR
YMPQNRHTFQYRVWHFVVSPSFEYTIMAMIALNTVVLMMKYYSAPYTYELALKYLNIAFT
MLFSLECILKIIAFGFLNYFRDTWNIFDFITVIGSITEIILTDSKLVNTSSFNMSFLKLF
RAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIAMLFFIYAIIGMQVFGNIRLEEDS
HINRHNNFRSFFSSLMLLFRSATGEAWQEIMLSCLSDKGCEPDTSAASGHNENERCGTEL
AYVYFVSFIFFCSFLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFVRIWAEYDRAACGR
IPYKDMYKLVRVISPPLGLGENCPYRVACKRLVLMNMPVSEDMTVHFTSTLMALIRTALD
IKIAKGGADRQQLDSELQKDILAIWPNLSQKMIDLLVPMPRASDLTVGKIYAAMMIMDYY
KQSKAKKQRQQLEEQKNAPMFQRMEASALPEEILSNAKALPYLQQDTLSGLGGFPSLSPL
SPEEVFQPPCLDGEEEEDFEEQLSLEPEVREFRREQLPNRGSYIPVEMLERPASVRASSM
PRLAENPQVLSDVSSMRRSFSTTAEKRVRSSWLDEFTMDRSSTDCAYRYQRRSYHASLRL
SAHRLNTDTGHWSDNHRSGGRERGRSKERKHLLSPDPSRCNSEERSPQAACEHRDHQLSP
GHTPSSVQILDSLSESCTPSDTSTPRRGRRQLPSVPPTPRPLISFSSLIRRQKHSPPPQN
KNDTILPSEPGLTESSCSLGGHQSSQSTPQHYISEPYLALHEEMQSSDCPAEDTLTFEVA
VATSLGRSNTIGSAPLRHGWQMPNGHYRRRRKGGIPPVIPSRELSDTEEDDRC
NT seq 7182 nt   +upstreamnt  +downstreamnt
atggtattaaagatgctgggattaagctcctgttcaaccagtgctcatacactcaatgag
cctgaccagtcaagcacactagccataccagcattggatgccgacactcagagatatgtc
ttggcccttccagaagcagagacatggcgcaagcatcgattgggcctgacacaggctact
cactcttgcaatcttctagaacctgagacactttctgaaaccctagtttcacgcactgca
agttacgatgccttgtatgacctgcgagcaagagaagcggagtctaacttcccatttgaa
ggcagcagcatgtttgaggtgacgtctgggatggattctgagtttcctttaagcccccat
gttataaagcgaaggagaggaggcctgatagaacaaaaggatatcatcaaggcccacgaa
gctcataagattcagagtactccccaggctcgacggaaggaatgggagatggctcgtttc
ggagaggctgtgactggcaggttgagctccgcagatgggggctcagagaggagcaagacc
ctacaaggttccccagctgcacctgttgggacccaagcagctttcaagcaatccaaagcc
cagagggcaaggaccatggctttatacaaccccatccctgtccgacagaactgcttcacc
gtgaacaggtctctcttcattttcggagaagataatattatcaggaaatacgccaagaag
ctcattgattggcctccttttgaatacatgatccttgccacaattattgcaaactgcatt
gtcctggctttggagcagcatcttccaggcgatgacaagactccaatgtctcgcagattg
gaaaagactgagccctatttcattgggatattttgctttgaagctggaattaaaattgtc
gctctgggactggtttttcacaaaggttcttatcttcggaatggctggaatgtcatggac
tttatagtagtgctcagtggcatcctggccacagctggaactcacttcaatactcacgtg
gacctgcgtactttgcgggcagtgcgtgttctcaggccgttgaagctggtctcggggatt
cccagtttacagattgtgttgaagtcaatcatgaaggcgatggtccctctgctacagatt
ggattgttgctcttctttgccatccttatgtttgctatcatcggccttgagttttacagt
ggaaagctacacaaggcctgttacaggaacaactctggaatggagctagaccccatggat
ccacctcacccttgtggagtgccccgctgcccagctgggtatgagtgcaaggaatggatc
ggacccaatgatggaataacacagtttgacaacatcctatttgcggtgctgacagtcttc
cagtgtataactatggagggctggaccacagtgctgtacaataccaatgatgccttagga
gccacatggaactggctgtacttcattcccctcattatcatcggatccttctttgtcctt
aatcttgtccttggagtgctgtccggtgaatttgccaaagagagggaaagagtggaaaac
cgccgggctttcatgaagttgcgcaggcagcagcagattgagagggagttgaatggctat
cgggcatggatagataaagctgaggaagtcatgttggcagaagaaaacaaaaattctggg
acctctgctttagaagttcttaggcgagcaaccattaaacgaagtagaacagaagccatg
aaccgggactctactgaggaccattgtgttgacatatcctctgttggcaccccccttgct
agagcaagcatcaaaagtaccaaaatggatggggcatcatattttcggcacaaggaaaaa
ctattgcgtgtctccgttcgtcacatgatcaaatcccaggttttctactggatggtcctg
ggagtggtagcacttaacactttctgtgtggctattgtccatcacaaccagaccctgtgg
ctctcaaatgttctttactatgcagaatttctgtttcttgggttatttttggtggagatg
gcttttaaaatgtatggaatgggtccacgtctttactttcactcatccttcaactgcttt
gattgcggggtcacaataggtagtatatttgaagtactttgggccatatttagaccagga
acttcctttggaatcagtgtcttaagagctctccgacttttgagaatcttcaaaataaca
aaatactgggcctcactacgaaaccttgtagtatcattgatgaattctatgaaatccatc
atcagcctgctcttccttctattcctcttcatagttgtttttgctctccttggaatgcag
ttatatggtggcagattcaattttaatgatggcactccttctgcaaactttgatacattc
cctgcagccatcatgactgtattccagattctgacaggagaggattggaatgaagtgatg
tacaatggtattcgctcccaaggtggtgttcgatccggaatgtggtcttccatatacttt
attgtccttaccctttttggaaattacacactgctaaatgtatttcttgccattgctgtg
gacaacctggctaatgcacaggagttaactaaggatgagcaagaagaagaggaagctttc
aatcagaagcatgcactgcaaaaagcgaaggaggtcagccccatgtctgcacctaatgca
tcatgtattgagaaggagcgcagaaaacggcacacattgtctatatgggagcagcgcaca
agccagctaaggaggcacatacagatgtctagtcaagaagctctccagagtgaagaactg
gcagcattgaatccacactccagtatctatcgcaagacaaaggaagctgctgaacaaaac
acagaaaaagaagaagtgcatcaagacgcaaaactggcaatagacccagttgaaggacca
ccagaaggtgaaggaagcccttctaatagaaatctcagggaaaactggcgccagaagtcc
aggcatggaaattctgaaaacactgagccaaatggaacaactccagaagaagcaatgcgc
cgcagacaaagtcagagacgcagccgtcatagaagagttagaactgaaggtcgtgagcag
tgtagcaatccaaacagtacctcagcaagcagagaaggtggtcttgacaaagtctctgca
gaggatggaagaacaattccagaagagaagagcaatggagaagccaaagaagtcaaaggg
gttgatgatgagcctctaaagatttgtatatcttcaagaaattgcgaggacagaaatatc
aggactttgggttgtgagggtattgccttgaacgatacacccctgcaggatgtgaacagc
caagagaaggacagtagccctcctgatttggattgcagtgagcaggctctgttgggcagc
attcagagccaggaaagccctaatccaaccagctgcagtttgccagatgtgtccagcagc
accgagagagtcacagagagcaccgtcattaccttaccagatactggaatgcccaccgac
tgcaccgtggtacagatgagtgaaggcagggatggagaagtcaactttgggtcttcgcag
caagaaaaagaagaggaggaagctgaggatggagaagaaagaactataaaaagaaaagag
aaattgttggagtcccccaaagccattgtaccgtacagttcaatgctcatcttcagctcc
accaatcccataagaaaagtatgtcattacattgttaacctacgatactttgagatgagc
atcctgctggtaatagcagcaagtagtatagccttagcagcggaggaccctgtactgacc
aactcggaccgcaacaaagttcttcgctattttgactatgttttcacaggggtcttcact
tttgagatgattataaagatgattgaccaaggtttgattttacacgagggctcctacttt
cgtgacctatggaacatcttggattttgttgttgttgtgggagccttaattgcgtttgcc
ttagcgaatgttttggggactaacaaaggccgggacatcaaaaccattaagtctctacgt
gtgttacgggtgctgcgtccactaaaaacaatcaaacgcctgccaaaactgaaggcagtc
tttgattgtgtggttaactctttaaagaatgtctttaatattctcatcgtatacaaactc
ttcatgttcatatttgctgtaatcgctgtccagctgtttaagggcaagttcttctattgt
acagacagctcaaaggagacagagaaagagtgcatagggagttacatcgatcacgaaaag
aacaagatggaggtgaagcggagagagtggaaaagacatgatttccattatgacaacata
atatgggctcttcttaccctctttactgtatcaacaggggaaggctggcctcaggttctg
cagcactctgttgatataactgaagaagataggggtccaagccgaagcaaccgtatggag
atgtccattttctatgttatctactttgtggtcttccccttcttctttgtaaatatattt
gtggctctgattatcatcacattccaggagcaaggagacaagatgatggaggaatgttcc
ctagaaaagaatgagagagcctgcatagactttgcaataagtgctaagccacttacacga
tatatgccacagaacaggcacacattccagtaccgggtctggcacttcgtggtctcccca
tcatttgaatacactatcatggctatgattgcactaaacacagtggtactcatgatgaag
tattattctgcgccatacacatatgagcttgcattaaagtatctcaatattgcattcaca
atgctattttctctggagtgcatcctgaaaataattgcatttgggtttttgaattacttt
cgggatacttggaacatttttgacttcattactgtaattggtagcatcacggaaattatt
ctaacagatagtaagttggtgaacaccagcagctttaatatgagctttctgaagctgttc
cgagcggcgcgacttattaaacttctccggcaagggtacaccatccggatcctgctgtgg
acttttgttcagtcctttaaggcacttccttatgtgtgtcttctcattgcaatgttgttc
ttcatctatgccattattgggatgcaggtgtttggcaatatccgcctggaagaggacagt
catattaataggcacaacaattttagaagcttctttagttctcttatgttactcttcagg
agtgccacaggagaagcgtggcaggagatcatgctttcatgccttagtgataagggttgt
gagccagacaccagtgcagcctctggacacaacgagaatgagcgctgtggaactgaactt
gcatatgtttattttgtttcattcattttcttctgctccttcctcatgctaaatctgttt
gtggctgtcattatggacaactttgagtacttgacacgggactcttccattttgggacct
catcacttggatgagtttgttcggatatgggctgaatatgatcgagcagcatgtggcagg
atcccctataaggatatgtacaaattagtccgagtcatctcgcctccgctcggcctagga
gagaactgcccatacagggtggcatgcaagagattggtcctgatgaatatgccagtgtcg
gaggacatgacggttcatttcacatcaactcttatggccctaatacgcacggcactggat
atcaaaatagctaaaggaggtgctgacaggcaacagctggactcagagctgcagaaagat
atacttgccatttggccaaatctctcccagaaaatgatcgacttacttgtgccaatgcca
agagcctctgatctgacggtggggaagatttacgctgcaatgatgatcatggattactat
aaacagagcaaagcgaaaaaacaaaggcagcagctggaggagcagaaaaatgcacctatg
tttcagagaatggaggcttctgccctccctgaggagatcttatccaatgccaaagcttta
ccataccttcagcaagacactctatcaggcctgggtggatttccttcactgagtcccttg
tccccagaagaagtattccagccgccatgcctagacggggaagaggaggaagactttgaa
gagcagctgtctctggagcctgaggttagagagtttagaagggagcagctccctaaccga
ggcagctacatccctgtggagatgctggaacgtccagcgtctgtgagagcttcttccatg
ccacgtctggctgagaatcctcaggtcctgtcagacgtaagctccatgcgtcgctccttc
tccacaactgcagagaagcgagtgcgcagctcgtggctagatgagttcactatggacagg
agtagcactgactgtgcatacagataccagaggcgcagttatcatgcatccttaagactg
tctgcacatcgcctgaatacagatacaggtcactggtcagataatcaccgttctggcgga
agggagcgaggaaggtccaaagagagaaaacacttgctgtcacccgatccttcccgctgt
aattctgaggaaaggagcccacaagctgcctgtgaacaccgagatcaccaactgtcccct
gggcatactcccagtagtgtacagattcttgactctctgagtgaaagttgtaccccttca
gacaccagcaccccaagaagaggccgtagacagcttccttctgtgcctccaactcctaga
ccccttatctctttctcctcgttaatccgccggcagaaacacagcccccctcctcaaaat
aaaaatgatactatccttcctagtgagcctggtctgactgagtcttcctgctcccttggg
ggtcatcagagctcccagtccacaccacagcattatatctcagagccctacctggcactg
catgaggagatgcaaagctcagactgcccagcagaggacacactcacctttgaggttgct
gtggctactagtctgggccgctcgaacaccattggctctgcccctctacgtcatggctgg
caaatgcccaatggtcactaccggcgtcgaaggaagggaggaattccaccagtgataccc
tccagagagttaagtgacacagaagaggatgatcgatgttaa

DBGET integrated database retrieval system