KEGG   Xenopus tropicalis (western clawed frog): 100488855
Entry
100488855         CDS       T01011                                 

Gene name
atf6b
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X2
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04141  Protein processing in endoplasmic reticulum
xtr04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100488855 (atf6b)
 09150 Organismal Systems
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    100488855 (atf6b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xtr03000]
    100488855 (atf6b)
Transcription factors [BR:xtr03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    100488855 (atf6b)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 Yuri_gagarin RIC3
Other DBs
NCBI-GeneID: 100488855
NCBI-ProteinID: XP_002941309
Xenbase: XB-GENE-1013925
LinkDB
Position
8
AA seq 648 aa
MCWVAVRGHISGSGRCQNTYIHRGHKKTVTMGTELLLNDLDTKFCADNLLTNEDWETGLY
SYLDEADENGELFNHYPLQLFDSHMDVDSCSMSSSWDEIHSKNLSDLLVKTEPASPFSSS
SSCDSSSSCDGLYTQSLRDIETAIKVELPPSPPCSSHDPSLSQCSALQITLLPVHPGTGQ
SGCLSKASTLLSKKPPLQPRPAPGTKPQPTSNGNTPHTIILHPVTSAPPAGPVPAITASP
PVLVSQLLTVQNGGTGTPPVKPEAKTIVPAPCAGKNNPAEVDPKLLKRQQRMIKNRESAC
QSRRKKKEYVQGLEARLQETERLLENSRRENRELRETVQHLMKENASLRVSSGRKVVCVM
VVLVFVAFNFGPTSLSSSILKEPGRSPEISHHTRHLLTYQSEEDASKNSGSKYYTSQSPA
SVGKFSNSSLANVKHLMVRDLDQLFLKSDCRHFNHTESLRLADELRLWVRRHQNERKNGK
QQAKKPRRVKKPLIRKAISLSDLVPAQPSRVTHRLHSAPLQLYNPSEPSDNFLMDAIERR
EDTFYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMSVNDSVYNTTRGYETMMQIDCEVM
DTRVIQIRSSTVPPSLRTGPSPPAQKETPHGNLSLYLQDHTPSDDGQD
NT seq 1947 nt   +upstreamnt  +downstreamnt
atgtgttgggtagcagtgaggggccacatctcaggatctggcaggtgccaaaatacatat
attcatagaggtcacaagaagacagttacaatgggaacagagcttttgctgaatgacttg
gatacaaaattctgtgccgacaatctactgacgaatgaagactgggaaacaggactttat
agttacctagatgaagcagatgagaatggggagctgtttaaccactatcctcttcaactg
tttgacagtcacatggatgttgactcctgttccatgtcatcttcctgggatgagatccac
agcaagaatttatcagatctgctagtaaaaactgaaccagcatcgccattctcctcttca
tcttcctgtgattcttcctcctcctgtgatggcctttatacacaatctctgagggatata
gagactgccataaaggttgaacttcccccatcgcctccctgttcaagccatgatccttct
ctctcccagtgcagtgctttgcaaataacacttcttccagtgcaccctgggacaggtcag
tctggatgtctttctaaagccagcacccttctgtccaagaagccacctttgcagccaaga
cctgctcctgggactaaacctcaacctacttcaaatggcaatacaccacacaccatcata
ttacatcctgtcacaagcgctcctcctgcaggtccagtgccagcaatcacagcttcacca
ccagtgctcgtctcccaacttcttacagtgcagaatgggggaacaggaaccccaccagtt
aaaccagaagccaagaccattgtgccagccccctgtgccggtaaaaacaaccctgctgag
gtggatcccaaacttttaaagagacagcaacgaatgatcaagaacagggaatcagcatgt
cagtctcgtcgaaagaagaaagaatatgtgcaggggttggaggcaagactgcaggagaca
gagaggctgctggaaaattcccgtcgtgagaacagggaactgagagaaacagttcagcat
ctaatgaaagagaacgcatccctccgtgtctcctctggaagaaaagttgtctgtgtcatg
gttgttcttgtgtttgttgcattcaactttgggcctacaagtttgtcaagtagtatactg
aaggaaccagggagaagtcctgaaatttcccatcatacccgtcatttactaacttaccag
agtgaagaggatgcttctaagaattcaggatctaagtactatacatcacagtcacctgcc
tctgtaggaaagttcagtaatagttccctggcaaatgtaaaacaccttatggtcagagat
cttgatcagcttttccttaaatcagattgcagacatttcaaccacacagaatctctcaga
ttagctgatgaactccgattatgggttcgccgccatcaaaatgaaaggaaaaatggaaag
caacaagccaaaaagccaagacgagtgaagaagcctctaataagaaaagctatttctctc
tcagacctagtacctgctcagccctccagagtcacacataggttacacagtgctcctttg
cagctctacaacccctcagagccaagcgacaatttcctcatggatgccattgaaagacga
gaggatacattctatgttgtgtcctttcgcagggatcaccttctccttcctgctataagt
cacaataaaacatcccgacccaaaatgtctcttgtaatgccagctatgtctgtgaatgac
agtgtatataacacaactcgtggctatgaaacaatgatgcagatagattgtgaagtaatg
gacactcgagttatccaaattagatcgtccactgtgccaccttccctacgcacagggcct
tctcctcctgcccaaaaggagacgcctcatgggaacctctcactctatcttcaggaccat
actccgtcagatgatgggcaggactga

DBGET integrated database retrieval system