KEGG   Xenopus tropicalis (western clawed frog): 100489201Help
Entry
100489201         CDS       T01011                                 

Gene name
map3k14
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 14
  KO
K04466  mitogen-activated protein kinase kinase kinase 14 [EC:2.7.11.25]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04210  Apoptosis
xtr04625  C-type lectin receptor signaling pathway
xtr04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    100489201 (map3k14)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100489201 (map3k14)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    100489201 (map3k14)
   04672 Intestinal immune network for IgA production
    100489201 (map3k14)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xtr01001]
    100489201 (map3k14)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     100489201 (map3k14)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: STE group
  Other
   100489201 (map3k14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal APH Kinase-like
Motif
Other DBs
NCBI-GeneID: 100489201
NCBI-ProteinID: XP_002935595
Xenbase: XB-GENE-1003188
LinkDB All DBs
Position
10
AA seq 867 aa AA seqDB search
MAVGRQQSSQLDPEIPKKLYKCEGMVGKETVAMEWPWSEVIQKGTAKEGKQCPSVYISII
AQPECENNHEICPSSKQHQIYNTDSKQYSHLDTEHIANNVVNSTEGKPARQSKPPCVKGK
KAKRKRRQKNSPQNTEQRGQRIPEQECRAPIPVQDEESQQSLEHLNVWRTDRKEKTSGLR
GQQNTISNEHPPQGLYLLKDDGLKEHHKLIDLKQCIYHIGGGKLPPSKLQVPPLDSLSIS
EFLKTLGTKRSCDLDYGKTTSPEYGSSKLTRPYEDSKTDSVEECMFAALRGSVSMGEPKS
LCTFAKAWNQEADDEDREMDTEGVILTEKLKAEDYEYKEGIHWTQDGKALGSGSFGDVLP
AKDEQTGLRFAIKKIHQSRFRSQELTSCLLVSSPKLVPVYGAVREGPWINVFLKLMTGGS
LGQLIKINGYLPEDRALYYLGQVLEGLTHLHAKSLVHGDIKADNILLSEDGNDAYLCDLG
HSAYLPTDGCKKQLLTADYVPGTETHMAPEIVRGDTCDTKLDVWSSCCMMLHMLNGWHPW
SRTHTPPLCLKIATEPPPVQEIPPTCDPRTREVIVAGLEKDPTSRVTAAKLQEKVNLALH
KIGGLKSPWKSEYKMPRSFPDTTSPPSLAVASETPLSKHEPAMLDTKPNPNKTKPERSKE
KTVSGLTDNRAVQPNILCGKEIQQKEREYLLTDLFLASSLEEQEQMLSCLSEDNRDQHRS
HKDSVHTFDTASSGIYSWDSEMDPLSLKSDSLINVGVTTTPSWFNGCKVQLQTLSGEKLH
IWESGRTKLGELAVGISSQIPLQSFTILTPEGKPIPSTTDISDCGIYLQCALAPDHGGGW
DWRVMRGKLEQGPTGEVYTGGGSAGSS
NT seq 2604 nt NT seq  +upstreamnt  +downstreamnt
atggctgttgggcgtcagcagtcctctcaacttgacccagaaatacccaaaaagttatac
aaatgtgaaggcatggtgggaaaagagacggtggccatggagtggccatggagtgaagtg
atacagaaaggaacagccaaggagggaaaacaatgtccatctgtgtacatctcaatcatc
gcacaacctgaatgtgagaataatcacgagatctgcccaagttccaagcaacatcagatt
tacaacactgactccaaacaatacagtcacttggacactgagcacatagccaataatgtg
gtgaactcaacagagggtaagccagcccgtcagtcaaagcctccatgtgtcaaagggaag
aaagcaaagcgaaagagaagacagaaaaatagtcctcagaatacagaacaaagagggcaa
aggattcctgagcaggagtgtcgggcccctatccctgtccaggatgaagagtcacagcaa
agcctggaacatctaaacgtttggaggacagataggaaggaaaagacttctggtttaaga
ggacaacaaaacacaatatctaatgaacatccccctcaaggcctctatctacttaaagat
gatggactgaaagaacatcacaagctcatagaccttaaacagtgcatataccacatagga
ggcggtaaactgccaccgtccaaactccaagtcccacctctagatagcttaagcatttct
gaattccttaaaaccttggggacaaaaagatcttgcgatttagactatggaaagaccacg
agcccagagtatggctcctccaagctcactagaccttatgaagactcaaagactgattct
gtggaagaatgtatgtttgcagctctgagaggcagtgtgagcatgggggagccaaaaagc
ctgtgcaccttcgccaaggcctggaaccaagaagcagatgatgaggatagagaaatggat
actgaaggggtcattctaacagagaagctaaaggcagaggattatgagtacaaggaaggt
attcactggacacaagatggaaaagctctgggatctggatcctttggagatgtacttcct
gcaaaggatgagcaaactggattaagatttgcgatcaaaaagatacatcagagcagattc
cggtcccaagagctgacttcatgccttttggtctcatccccaaaacttgtcccagtgtat
ggagcagtccgggagggaccctggatcaatgtatttcttaagctcatgacaggaggttcc
ttgggacaactcatcaagataaatgggtacctaccagaagatcgggccctttactacctt
ggacaggtactggagggccttacacaccttcatgcaaaaagccttgtgcatggggatatt
aaagctgacaatattctcctatcagaagatggtaatgatgcctacctttgtgatttgggg
cactctgcttatctgcccacagatggttgcaagaagcagctactgacagcggactatgtt
cctgggacagagacacacatggcccctgaaatagtgcggggggacacctgtgacacaaag
ctggacgtgtggagctcctgctgtatgatgctacatatgcttaacggctggcacccatgg
agccgaactcacacaccgcctctgtgcctgaaaattgccactgagccaccccccgtgcag
gagataccccccacctgtgatcctcgaacacgtgaggtcattgtagcgggtctggaaaaa
gatccaaccagtagagtgacggcagcaaagttacaggagaaagtgaatttggctttgcat
aaaatcggtggtctgaaatctccatggaaatctgaatacaaaatgcccaggagctttcca
gataccacatcaccccccagccttgctgtagcatctgaaacccctctttccaaacatgaa
cctgccatgcttgataccaagcccaatcctaacaaaactaagccagaacgtagcaaggag
aagacggtcagtggcctgactgacaacagggcagtgcagccaaacatcttgtgtgggaag
gaaattcagcagaaggaaagagaatatcttctcactgatctgttcctggcaagttccctg
gaagaacaggagcaaatgttgtcctgtctgagtgaggacaaccgggatcagcatcgcagt
cacaaggactcagtacatacttttgacacagcgagctctggaatttattcttgggacagc
gagatggatccactgagcctcaaaagtgactcccttattaatgttggggtcacaaccact
cccagctggttcaacggttgcaaggttcagctgcaaacactgagtggggaaaagctgcac
atctgggaatctggaaggactaagcttggagagctggcagtggggatcagcagtcagatc
ccgctgcagtccttcacaatactgaccccggaaggaaagcctattccatctacaacagat
atttctgactgcgggatatacctgcagtgtgccttagccccggaccacggtgggggctgg
gactggagagtgatgagaggaaagctggagcagggacccacgggagaggtgtatacaggt
ggaggcagtgctggtagttcctga

DBGET integrated database retrieval system