KEGG   Xenopus tropicalis (western clawed frog): 100489279Help
Entry
100489279         CDS       T01011                                 

Gene name
tmprss9
Definition
(RefSeq) transmembrane protease, serine 9
  KO
K09640  transmembrane protease serine 9 [EC:3.4.21.-]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xtr01002]
    100489279 (tmprss9)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100489279 (tmprss9)
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100489279 (tmprss9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin DUF1986 Ldl_recept_a Trypsin_2 SEA
Motif
Other DBs
NCBI-GeneID: 100489279
NCBI-ProteinID: XP_002940084
Xenbase: XB-GENE-993973
LinkDB All DBs
Position
1
AA seq 1151 aa AA seqDB search
MAEKNADIEPVLDVQKASFLGTPCCRWTVAFLLLGSLTISITAALLIMYLTTHSLIVVHT
LEVQGLQYDASLQNRTSLYHRYLTNTLQRLLRSSFRNTVAEEIYIGCTILQYSQGNESII
ASIKLQFRASSHFPGNEEIEELLRQGLASFLRGNTIPVPTFGNISAVLTDYHGQSFYSIG
LKSGSCPAQVFACKNTQCIVKQNPECDNIRDCKDGSDEKNCNCGTRPAMQKTNRIVGGSD
ATKGEFPWQVSLRENNEHFCGATVIGDKWLVSAAHCFNDFQDPAVWVAYIATTSLSGTDS
STVKATIRNIIKHPSYDPDTADYDVAVLELDSPLKFNKYTQPVCLPDPTHVFPVGKKCII
TGWGYLKEDNLVKPEVLQKATVAIMDQSLCNSLYSNVVTERMLCAGYLEGKIDSCQGDSG
GPLVCEEPSGKFFLAGIVSWGVGCAEARRPGVYVRVSKIRNWILDIISSSVAADPQTSFT
TTTTTTTGGRKTTNAKTTTARPFTKHSTTRAKPASSTLPSKPTQKPFSTIKPQECGSRPG
LTKPNKIVGGLDAVRGEIPWQASLKEGSRHFCGATIIGDRWLVSAAHCFNQTKVDQVTAH
MGSTALSGADTIAIKISLKRVIQHPHFNPLTLDFDVAVLELASSLTFNKYVQPVCLPSAL
QKFPAGWKCMISGWGNIKEGNVSKPEVLQKASVGIIDQKICSVLYNFSITERMICAGFLD
GKVDSCQGDSGGPLACEESPGIFFLAGIVSWGIGCAQAKKPGVYSRVTKLKDWILDTVAP
VLRTTDSGMNLPRSSPLPISTTRPSTFQPATSNGRRTTTLTRPTMSQTKSTRSTPRSTTK
YTSKRTTTAKTSPTALRITEPARSTQRPVPCSASTYKCSNRVCISKPNPECDGIQDCNNG
SDEQNCDCGFAPVLPFNKIVGGSGSVRGEWPWQVSLWLRRKEHKCGAVLISDRWLLSAAH
CFDIYSDPKLWAAYLGTPFLNGVEGRVEKIFRIHKHPFYNVYTLDNDVALLELPSPLTYT
NLIRPICLPDISHIFPEGTRCFITGWGSTKEGGAMSRQLQKASVSIVGDQTCKKFYPIQI
SPRMLCAGFMQGGVDSCSGDAGGPLACREPSGRWFLAGITSWGYGCARPYFPGVYTRITS
VRNWIGQNLRL
NT seq 3456 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagaatgcagatattgagccagtgctggatgtacagaaggccagttttcta
ggcacaccttgctgcagatggactgtggcctttctacttctcggaagccttaccatcagc
atcacagcagcattattaataatgtatttaacaactcatagcctcattgtggtacatact
ctggaggtacaaggacttcagtatgatgccagtctacagaatagaacctcattgtaccac
aggtatttaaccaatacactgcagagactgctcagaagcagtttcaggaacactgttgca
gaagaaatctatattggatgtaccattttacaatacagccaaggaaatgaaagcattata
gcttccataaaattacagttccgtgcttctagccactttcctggcaatgaggaaatagaa
gaactacttagacagggcctggcttctttcttaagaggtaacaccattccagttcccaca
tttggaaatatctcagctgtacttacagattaccacgggcaatccttctactccataggc
ctcaagtcaggaagttgcccagcacaagtatttgcctgcaagaatacacagtgcattgta
aagcaaaaccccgagtgtgataatattcgagactgtaaagacggatcagatgaaaagaac
tgcaattgcggtacacggcctgccatgcaaaaaaccaacagaatagttggtggatcagat
gctaccaaaggagagtttccatggcaggtcagcctaagggagaacaacgaacacttctgc
ggagcaactgttattggtgacaagtggctggtgtctgcagctcattgcttcaatgacttc
caggacccagcagtgtgggtagcttacatagcaactacctctctgagtggcacagacagc
agcacagttaaggccacaattaggaacatcatcaagcacccttcttatgacccagacaca
gctgattatgatgttgctgtattggaactggattccccactcaagttcaacaagtacact
caaccagtttgcctcccagacccaactcatgtatttccagtcggcaagaaatgtattata
actggatggggctaccttaaggaggacaacttggtgaagcctgaagttctacaaaaggca
actgttgccatcatggaccaatctttgtgcaatagtctctatagcaatgtggtgacagaa
aggatgctgtgtgctggttacttggagggaaagattgattcctgccagggtgattctggt
ggtccattggtgtgtgaggagccatctggaaagtttttcttggcaggaatagtgagctgg
ggtgtaggctgcgcagaggccaggaggcctggtgtttatgtgagagtaagcaagatcaga
aactggattctggatataatttcttcatctgttgctgcagatccacaaacaagctttact
actaccaccactaccactactggtggacgaaaaacaactaatgcaaaaaccaccactgcc
cgaccatttaccaagcattcaactaccagagccaaaccagcgagcagcactttaccttct
aaacctacacaaaagcctttcagcactatcaagcctcaagaatgtggcagtcgtcctggt
cttactaaacccaacaaaatagtggggggactagatgctgtcagaggagagattccatgg
caagcaagcctaaaagagggctcacggcatttctgtggggccacaataattggggaccgg
tggctggtgtctgctgctcactgctttaaccaaacaaaagtagaccaagtcacagctcat
atgggatccacagcactaagtggcgctgacaccatagctataaagatcagcttgaagagg
gtaatccagcatcctcactttaatccattgactttggacttcgatgtggctgtgctggaa
ctggctagctcattaactttcaataagtatgttcagcctgtttgccttccctctgccctg
cagaagtttccagctggttggaagtgcatgatatctggatggggaaacataaaagaaggc
aatgtgtctaaacctgaggtcctacaaaaggcctcggtgggaataattgaccagaaaata
tgcagtgtcctttacaacttttccatcactgagaggatgatttgtgcaggatttctggat
ggaaaagtggattcttgtcagggtgactctgggggtcctttggcatgtgaggaaagtcca
ggaatattctttttggctggtattgtaagctggggtattggatgtgctcaggcaaaaaaa
cctggagtttacagtcgagtcactaaacttaaggactggattttggacacagtagctcct
gtcttgaggacaacagacagtggaatgaatcttcctagatcatcccccctacctatttct
acaacaagaccatctacttttcagccagcaacctccaatggccgaagaacaacaacttta
acaaggcctactatgtctcaaacaaaaagcacaaggagcacacccaggtccaccacaaaa
tatactagcaaaagaacaactactgccaagaccagcccaacagcattacgaattacagag
cctgccagatccacacaaagaccagtgccatgttctgcctccacctataaatgctccaac
agggtctgcattagtaaacccaatcctgagtgtgatggaatccaagactgcaataatggg
tctgatgagcagaactgtgattgtggctttgcacctgtactaccatttaacaagatagtt
ggtggcagtggttctgtaaggggagaatggccatggcaagtcagcctttggctacggagg
aaggagcataagtgtggagcagttctgatttctgaccgttggctactttctgctgctcac
tgctttgacatttacagtgaccctaagctatgggcagcatatctaggtactccatttcta
aatggagtagaggggagagtagagaagatcttccgaattcacaagcatccattctacaat
gtctatacactggataatgatgttgcccttttggaattaccttcaccacttacttacaca
aacctcattaggcctatatgccttccagacatcagtcatatcttcccagagggaactaga
tgtttcatcacaggctgggggtctaccaaggaaggaggtgcaatgtcaagacaacttcaa
aaagcctctgtcagcattgttggagaccagacctgcaaaaaattctaccccattcagatt
agtcccagaatgttgtgtgctggttttatgcaaggtggcgtggacagttgttctggtgat
gctgggggacccttggcatgtagggagccatctggtcggtggtttctagcaggaataacc
agctggggttatggttgtgcaaggccttatttcccaggagtttacactcggataacatct
gtccgcaactggattggacagaatctacggttatga

DBGET integrated database retrieval system