KEGG   Xenopus tropicalis (western clawed frog): 100489358Help
Entry
100489358         CDS       T01011                                 

Definition
(RefSeq) probable N-acetyltransferase CML6
  KO
K20838  N-acetyltransferase 8 [EC:2.3.1.80 2.3.1.-]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00480  Glutathione metabolism
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    100489358
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.80  cysteine-S-conjugate N-acetyltransferase
     100489358
    2.3.1.-  
     100489358
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_7 Acetyltransf_10 Acetyltransf_9 Acetyltransf_3 Acetyltransf_CG FR47
Motif
Other DBs
NCBI-GeneID: 100489358
NCBI-ProteinID: XP_004911545
Xenbase: XB-GENE-988088
LinkDB All DBs
Position
1
AA seq 223 aa AA seqDB search
MGHIIRIYKDSDYESVIDLYVSGVMENAPVAFKQLLGFPSTQLLLAVGFLLSLAATGSIL
LPTCIVLCALAFLWWCCRDFFCFYVTNALVTDMRDIRKHYIEMDGHCFWVAESAGEVVGM
VAALPFLHPGGEKYVELKRMSVAKSHRGMGIAKDLCRTSIDFACKRGCDGVVLTTSTGQV
GGWNLYEKTGFIRTHSSSPPNWSTRLSGIKLLHYQYNIKRGGQ
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgggtcacataatccggatttacaaggactcagattatgagtccgtcatagacctttat
gtctctggggtcatggaaaacgctccagtggccttcaagcaactactggggttcccaagc
acccaacttttgctggcagttgggtttctgctctctcttgctgccaccggctccatcttg
cttccaacctgcattgtgctctgtgccctggccttcctctggtggtgttgtcgagatttc
ttttgtttttatgttaccaacgcccttgttactgatatgagagatatccggaaacattac
atagaaatggacgggcactgcttctgggtggcagagtcagcaggggaagttgttggcatg
gtggccgctctccccttccttcatcctggaggagagaaatacgtggaactgaagagaatg
tcagtggccaaaagccaccggggtatggggatcgctaaagatctatgtaggactagtatt
gactttgcctgtaagagggggtgtgatggtgtcgtacttaccacctccacaggtcaggtt
gggggctggaacctgtacgagaagactgggttcatccggacgcactcaagttctccccct
aattggtcgacaagactttctggaatcaagctattacactaccagtacaacatcaaaagg
gggggtcagtga

DBGET integrated database retrieval system