KEGG   Xenopus tropicalis (western clawed frog): 100489853Help
Entry
100489853         CDS       T01011                                 

Gene name
gp25l, g25l
Definition
(RefSeq) Glycoprotein 25L
  KO
K20346  p24 family protein alpha
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    100489853 (gp25l)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100489853 (gp25l)
Membrane trafficking [BR:xtr04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    100489853 (gp25l)
Transporters [BR:xtr02000]
 Other Transporters
  Others
   100489853 (gp25l)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EMP24_GP25L
Motif
Other DBs
NCBI-GeneID: 100489853
NCBI-ProteinID: XP_002937324
Xenbase: XB-GENE-955109
LinkDB All DBs
Position
1
AA seq 218 aa AA seqDB search
MNPIIAPYIMFLFFWPLSSAMYFHVAEKEEKCLIEDLPSETLVTGRYKIQKWDLKEHDFL
PSAPGLGMVVTVTAPNGEVLLSKLYGPDGKFTFTSHSPGEHTICLQSNSTNLIAFVSNKL
RIHFDIQSGENPLDFHIINAKDKVKEVTYGLEHLRGEINHIIKQQEYQREREEHYRGKSE
ETNNNVLWWAIIQTAILTSVGIWQIKHFKDFLIAKKVV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatcctataattgctccatatataatgtttctatttttctggcctctgtcatctgct
atgtattttcatgtagcagaaaaagaggagaaatgccttatagaagatctcccatcagaa
acactggtcacaggtcgttacaagatacaaaaatgggatttgaaagaacatgacttcctc
ccgtctgcgcccggactaggaatggttgtgactgttacagcaccaaacggagaggtattg
ctgtcaaagttatatgggccagatggaaaatttactttcacatctcattctcctggagag
cacacaatctgccttcagtccaattcgacaaaccttatagcttttgtttcaaataaattg
cgtattcactttgacatacaatcgggggaaaatccactcgattttcatataattaatgca
aaagacaaagttaaagaggtaacatatggtcttgaacaccttagaggggaaataaatcat
attattaagcaacaggaatatcaaagagagcgagaggagcattacagaggaaagagtgaa
gaaactaacaacaatgtgctgtggtgggctattatacagactgcaatcctaacatccgtt
ggcatatggcaaatcaagcactttaaggattttctgattgccaaaaaagttgtatga

DBGET integrated database retrieval system