KEGG   Xenopus tropicalis (western clawed frog): 100490061Help
Entry
100490061         CDS       T01011                                 

Gene name
galnt9
Definition
(RefSeq) polypeptide N-acetylgalactosaminyltransferase 9
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00512  Mucin type O-glycan biosynthesis
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100490061 (galnt9)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xtr01003]
    100490061 (galnt9)
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     100490061 (galnt9)
Glycosyltransferases [BR:xtr01003]
 O-Glycan biosynthesis
  Mucin-type
   100490061 (galnt9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin Glyco_tranf_2_3 Glyco_transf_7C
Motif
Other DBs
NCBI-GeneID: 100490061
NCBI-ProteinID: XP_002931923
Xenbase: XB-GENE-948907
UniProt: F6Z2B6
LinkDB All DBs
Position
1
AA seq 604 aa AA seqDB search
MAVARKIKTLLTVNILVFVGIILFSVYCRIQDRSQELVQIVRSSDRRVRSRGTKVGALVD
RESILQRLDHLEEVVYNQLNGLAKPMGLVEGPGGLGQGGMAATLRDDSHESETKYEEYGY
NAQLSDRISLDRSIPDYRPKKCKQMTYPDDLPQIAVVFIFVNEALSVILRSVHSVVNHTP
SYLLKEIILVDDNSDNVELKFNLDQYVNKRYPGLVKIVRNTRREGLIRARIQGWKAASAP
IVGFFDAHVEFNTGWAEPVITRIKEDRRRIILPAIDNIKYNSFEVQQYANAAHGYNWGLW
CMYITPPQDWLEKGDESAPIRTPAMIGCSFVVDRAYFGDIGLLDPGMEVYGGENIELGMR
VWQCGGSMEVLPCSRVAHIERTKKPYNNDIDYYAKRNALRAAEVWMDEFKSHVYMAWNIP
MTNPGVDFGDVSERVALRQKLQCRSFKWYLENVYPEMRVYNNTITYGELRNSKATGYCLD
QGSEDDNKAILYPCHGMSSQLVRYSSEGLLQLGPLGSTSFLPDTKCLIDDGKGRTPTLKK
CDDVPRSPQKLWDFTQSSPIVNRDTGRCLEVEMSKDANFGLRLVVQRCSGQKWIIRNWIK
HGRN
NT seq 1815 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcacgaaaaatcaaaactttgctgactgtcaacatcttagtctttgtgggt
atcattctcttctcagtgtactgcaggatccaggacaggtcccaggaactggtacagatt
gtcagaagttctgatcgcagagtaaggagcaggggtaccaaagtgggggctctagtggac
cgggagtctatacttcaacgactggaccacctagaggaagtagtgtacaaccagctaaat
ggtttagccaagcctatgggacttgtggagggacctggagggctcggacaaggtggtatg
gctgcaaccttgagagatgacagccatgaatcagaaacaaaatatgaggaatacggttat
aatgcccagctcagtgacagaatttcgcttgacagatctattcctgactacagacccaaa
aaatgcaaacagatgacttacccggatgacttgcctcagattgcagtagtctttatattt
gtgaatgaagctctatctgttatcctgcggtccgtgcacagtgtagtcaaccacactcca
tcctatctcctgaaagagattatactagtggatgacaatagcgacaatgttgagctgaaa
tttaacttggatcaatatgtgaataagagatacccagggctggtgaaaatagttcgtaac
acgagaagggaaggactcattcgagctcggattcaaggatggaaggcagccagtgcacca
atcgttggcttttttgatgctcatgtggaattcaataccggctgggctgaaccagtgatt
acaagaattaaagaagatcggagacgaatcattttaccagcgatcgataatatcaagtac
aattcatttgaagtgcagcagtatgcaaacgcagcccatggctataactgggggttatgg
tgcatgtacatcactcctcctcaggattggttagaaaaaggcgatgagtctgctccaatc
agaactcctgcaatgattggctgctcttttgtggtggacagagcatactttggagatatt
ggactgctagaccctggcatggaagtgtatgggggagagaacattgagctaggcatgaga
gtatggcagtgtggtggaagcatggaagttcttccttgttccagagtcgcccacatcgaa
cgcacaaaaaagccttacaacaatgacattgactactatgcaaagcgcaatgctttaaga
gctgctgaagtgtggatggatgagttcaagtcccatgtctacatggcttggaatatacct
atgacaaaccctggcgtggattttggggatgtctcagagagagtcgctctgcgccagaag
ctgcaatgccgtagttttaaatggtacttggaaaatgtatatccagaaatgcgagtgtat
aataacactataacttatggcgagcttcgaaacagtaaagcaactggctactgtttggat
caaggttctgaagatgacaacaaagctattctgtacccttgccatggcatgtcctcgcag
cttgtacgctacagcagtgaaggcctactccagttaggcccattgggttccacatccttc
cttcctgatacaaagtgtttgattgatgatggaaaaggcagaacccccacactaaagaaa
tgtgatgatgttccccggtcacctcaaaaactttgggattttacacagagcagccccatt
gttaatagagacactggtcgttgcctggaagttgaaatgtccaaggatgccaattttgga
ttacggttagtagtgcagagatgctcaggacaaaaatggataataagaaactggataaaa
catggaagaaattga

DBGET integrated database retrieval system