KEGG   Xenopus tropicalis (western clawed frog): 100490155Help
Entry
100490155         CDS       T01011                                 

Gene name
gys1, gsy, gys
Definition
(RefSeq) glycogen synthase 1
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00500  Starch and sucrose metabolism
xtr01100  Metabolic pathways
xtr04910  Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100490155 (gys1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100490155 (gys1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xtr01003]
    100490155 (gys1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100490155 (gys1)
Glycosyltransferases [BR:xtr01003]
 Polysaccharide
  Storage polysaccharide
   100490155 (gys1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glyco_transf_5 Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4
Motif
Other DBs
NCBI-GeneID: 100490155
NCBI-ProteinID: XP_002939278
Xenbase: XB-GENE-974345
LinkDB All DBs
Position
7
AA seq 736 aa AA seqDB search
MPLARSLSVTSLTGLEDWDDDLDLENSILFEVAWEVANKVGGIYTVIQTKAKVTTDEWGE
NYFLIGPYFENNVRTQVELIEPTHPAIKRALDSMNAKGCKVYFGRWLIEGSPYVILIDIA
ATAWNLDRWKTELWDSCDIGIPWYDREANDAVLFGFLTAWFLGEFSAQCEEKPFIIAHFH
EWLAGVGLCLCRIRKLPVATIFTTHATLLGRYLCAGNVDFYNNLQSFNVDKEAGDRQIYH
RYCMERAAVQCSHVFTTVSQITAIEAEHLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KGRIQEFIRGHFYGHLDFNLDKTLFFFIAGRYEFSNKGADVFLEALARLNYLLRVNHSET
TIVAFFIMPARTNNFNVETLKGQAVRKQLCDTANTIKEKFGKKLYESLLVGNLPDMNKML
DKEDFTMLKRAIFATQRHSFPPICTHNMLDDSTDAILNTIRRIGLFNSSSDRVKVIFHPE
FLSSTNPLLPMDNEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSVSTNLSGFGCFMEE
HIADPTAYGIYIQDRRFRSVDESCTQLTSFLYSFSQQTRRQRIIQRNRTERLSDLLDWKY
LGRYYTYARHMALAKAFPDNFTYEPHEPTAAQGFRYPRPASVPPSPSLSRHSSPHHSETE
DDERYDEEEEAEKDRQNIKQPSITSMASAPEWRRRSKKGSIDATNSSNASNASTPTNPSS
PSDLSSPTSSLIEERN
NT seq 2211 nt NT seq  +upstreamnt  +downstreamnt
atgcctttagctcgcagcctgtcagtcacctctctcaccggcctggaggactgggatgat
gacctggatctggaaaattccatcctgtttgaggttgcctgggaagtggccaacaaagtg
gggggcatttatacagtaattcagacaaaggcgaaggtcaccactgacgaatggggagaa
aactactttctgattggtccctactttgaaaataatgtgcgcactcaagtggagctgatt
gagccaactcatcctgccatcaaacgtgccctggactccatgaatgcaaagggatgcaag
gtatactttggccgctggctgatagaagggagcccgtatgtcatcttgattgacattgca
gccaccgcttggaaccttgaccgatggaagacggaactctgggacagctgcgacattgga
attccatggtacgacagggaagccaacgacgccgtcctctttgggtttctcacagcctgg
ttcctcggagagttttcagcccaatgtgaggagaagccctttatcattgcccatttccac
gagtggcttgctggtgtaggcctgtgtttatgccggatacggaagctccccgtggctacc
atattcactacacatgccaccctcctggggagatacctgtgcgctggaaatgtagacttt
tacaacaacctgcagtcgtttaatgtagataaagaagctggagaccgccagatctatcac
cgatactgtatggaacgagctgctgtacagtgcagtcacgtctttactactgtgtctcaa
atcactgccatagaagctgaacatctgctgaagcgcaagcctgatattgtgacaccaaac
ggtttgaatgtaaagaagttttcggccatgcacgagtttcagaacctgcatgcacagagc
aagggtcgcatccaggagtttatcagggggcatttttatggacatctagattttaatttg
gacaagactctgtttttcttcattgctggccgctacgagttctcgaacaaaggagcggac
gtgtttttggaggccttggccaggctcaactaccttctgagggttaatcacagtgaaaca
accattgttgcctttttcatcatgccggctcgaaccaacaacttcaatgtggaaactttg
aagggtcaagcagtgcggaaacagctgtgtgatacagccaacacgattaaggaaaagttt
ggaaagaaactatatgagtcattactagtagggaatttgccggatatgaataagatgctg
gataaggaggactttacaatgctgaagagagccatttttgccacacagagacactccttc
ccccctatatgcacccataacatgcttgatgactctacagacgccattttgaacactatc
cggaggatcggcctatttaacagcagctctgatagagtgaaggttattttccatccagag
ttcctttcctcaactaacccacttttgcccatggataatgaggaatttgtacgtggttgt
cacttgggagtcttcccctcttactatgaaccttgggggtacacaccagctgaatgtact
gtcatgggaattcccagtgtttccaccaacctctctggatttggatgttttatggaggag
cacattgctgaccccactgcttatggtatttacatccaagaccgacggttccgctcagtg
gacgaatcttgcacccaactcacatccttcctctacagcttctctcagcaaacccggcgg
cagcgcatcatccagaggaaccgcacagaacgcctctcagacttgttagattggaagtac
ctggggaggtattacacgtacgctcgacacatggctctggcaaaggccttccctgacaac
ttcacatacgagcctcatgaaccaacagctgctcagggattccgctacccacgcccggcc
tctgtacctccgtctccatccctatcccgacactccagcccgcaccacagtgagacagaa
gacgacgaacgatacgacgaggaggaagaagctgagaaagaccgtcagaacatcaagcag
ccgtccattacctccatggcctcagcccccgagtggcgcagacgctccaagaaaggttcc
atagacgccaccaactccagtaatgccagcaatgccagcacacccaccaacccaagcagc
ccaagtgacctcagcagtcccaccagctcgcttattgaagagcggaactaa

DBGET integrated database retrieval system