KEGG   Xenopus tropicalis (western clawed frog): 100490309Help
Entry
100490309         CDS       T01011                                 

Gene name
setdb1
Definition
(RefSeq) SET domain, bifurcated 1
  KO
K11421  histone-lysine N-methyltransferase SETDB1 [EC:2.1.1.43]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    100490309 (setdb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:xtr03036]
    100490309 (setdb1)
Enzymes [BR:xtr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     100490309 (setdb1)
Chromosome and associated proteins [BR:xtr03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     100490309 (setdb1)
  Heterochromatin formation proteins
   Other heterochromatin formation proteins
    100490309 (setdb1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF5604 SET Tudor_4 TUDOR_5 Pre-SET MBD DUF4537 Oberon_cc NeA_P2
Motif
Other DBs
NCBI-GeneID: 100490309
NCBI-ProteinID: NP_001238764
Xenbase: XB-GENE-853380
LinkDB All DBs
Position
8
AA seq 1284 aa AA seqDB search
MDSQETMELEQMVVKELGISMDDLHELIDRELEKIEFVKQRKAQLLELEQLVKQKEAEVD
HVDKLFDNATRAVDDCEMLVKSLYNQIGMTYKESSSEDEGSSKPVEVIEIPDEDDDDVMS
VGSGEAVSKIPKEKHLLREAMAAMKRSRQDVQSIVEAIQKKSDGPQTRFSSHPSSPTSSV
GGSNQASASNDMSKDGDLVVGMRILGKKRTKTWHKGTLISIQCVGPGKKYKVKFDNKGKS
LLSGNHIAYDYHPPPENLVVGSRVVAKYKDGNQVWLYAGIVAEPPSNKNKMRYLIFFDDG
YASYVTHAELYPVCRPLISSWEDIEDVSCRDFIQEYVNAYPNRPMVLLKSGQLIKTEWEG
TWWKSKVEEVDGSLVKILFLDDKRCEWIYRGSTRLEPMFSMKTSTASTQEKKQAGQQRTR
PNVGAIRSKGPVVQYTHDLTGSEPEPKPAAPPSPLSIPSPQLIDTDSDSQQAQSKKQVAK
KSTSFRPGSAGSGQSSPIPSESVPPPPPPPPPPPVVQRPFQSNQSVQPVQSIQSIQNIQT
IQTIQGIQTIQAIQPIQTIQTLQPIQTIQPLQTIQTLQGNRIVTSIQQIHIIQAENVPAE
TTYKAPKEKLFYLPHVCNYTCLSRIRPVSHRGKNPLLVPLLYDFRRMTARRRVNRKMGFH
VIYKTPCGLSLRTMPEIERYLFEVECRMLFLEMFCLDPYVLVDRKFQPQKPFYYIPDITY
GKEDVPLSCVNEIDRTPPPQVAYSKERIPGKGVFINTGAEYLVGCDCTDGCRDKSKCACH
QLTIQATGCTPGAQLNPMAGYQHKRLEECLPTGVYECNKRCKCSANMCNNRLVQHGLQVR
LQLFKTQNKGWGIRCLDDIAKGSFVCIYAGKILTDDFADKEGLEMGDEYFANLDHIESVE
NYKEGYESDAKSSSDSSGVDLKDDDEENTGSEDQDESNDSSDDNFGKNEDITTSSVWRSY
ATRRQTRGQKENGTSETASKDSALARQTSQDETTDCKLPEETSKNKVASWLSSNTMADSL
MDSDSRSSLKMGDASETDKPKESDEASKYPGFGEGNRMYGYNPAPAKKDGVRRPVSKTAL
HQNKRQSNSAQPTDEVLTLSSSSESEVGSGTNGTKKPAAQATANDSDDIQTISSGSDEEE
EKKNVATTAGPVKRQVAVKSTRGFALKSTHGITVKTNMASGEGGTGRRNTRQFFDGEESC
YIIDAKLEGNLGRYLNHSCSPNLFVQNVFVDTHDLRFPWVAFFASKRIRAGTELTWDYNY
EVGSVEGKKLLCCCGSTECRGRLL
NT seq 3855 nt NT seq  +upstreamnt  +downstreamnt
atggactcgcaggagaccatggagttggagcagatggtggtgaaggagctgggcatttcc
atggatgatctgcatgaactgatagacagagagctggaaaagattgagtttgtgaagcag
cggaaagctcagctactggaactggagcaactggtgaaacaaaaagaggcagaagtggat
catgtagacaagctttttgacaatgccacaagagccgtggacgattgtgagatgctggta
aagagtctgtacaaccaaataggtatgacctacaaggagagcagctctgaagatgaagga
tcttcaaaaccagtggaggttattgagatccctgatgaagacgatgatgacgtcatgagt
gtgggatcaggtgaagctgtgagtaagattccaaaagagaaacatttgttaagagaagca
atggctgctatgaagagatcaagacaagatgtgcagagcattgtagaagcaatccaaaag
aagtcagatggaccccagactagattttcttctcatccctcctcaccaacaagctctgtg
ggtggctccaatcaggccagtgcctcaaatgatatgagcaaagatggagaccttgtcgtg
gggatgcgtatcttgggcaagaagaggaccaaaacctggcataaaggaactctgatctct
atacagtgtgtgggtcctgggaaaaagtacaaggtcaagtttgacaacaaagggaaaagc
ctgttgtccggtaaccacattgcctatgactaccacccaccgcctgaaaatctggttgtt
ggtagcagagtagtagccaagtataaagatggaaaccaggtgtggctctatgctggaatt
gttgctgagcctccaagcaacaagaataaaatgaggtatctgatcttttttgatgatggc
tatgcatcctatgttacccacgcagaactgtatcctgtctgcaggcccttgatcagttca
tgggaggacatcgaggacgtgtcctgccgtgattttattcaggaatacgtcaacgcttac
cccaataggccaatggttcttctgaagagcggccagctgattaaaacagagtgggaagga
acgtggtggaaatccaaggtggaagaagttgatgggagtctggtgaaaatcctttttctg
gatgacaagcgctgtgaatggatctaccgaggttctacacgcctggagcccatgtttagc
atgaagacctccacggcctcaacacaagagaagaagcaagctgggcagcaacggacgcgt
cctaatgtgggtgccattaggagcaagggacctgtagtacaatacacacatgacctgact
ggcagtgagcctgaacccaaacctgctgcacccccatctcctctgtcaatcccatcaccc
cagctgattgacacagactctgacagtcagcaggcccagtccaagaagcaagtggctaaa
aaaagcacttcatttcgtccaggatcagcggggtccggtcagtcttcccccatccccagc
gaatcagtgccgccgccaccaccaccaccacctccacctcctgttgttcagcgtcctttc
cagtccaaccaatctgtacagcctgtccagtctatacagtccattcagaatatacagacc
atccaaaccattcaaggcattcaaaccatccaagctatccagccaattcaaaccatacag
actctccagcctatccaaaccattcagcctctgcagacaattcagactctccaaggaaac
aggattgtgacttctattcaacaaatccatataatacaggcggaaaatgttccggcagag
accacctacaaggcccccaaagaaaagcttttctacctccctcatgtgtgcaactatact
tgcctgtcgcgcattcgccccgtctcccaccgtggcaagaaccccctcttggttccatta
ctttatgacttccggcgaatgaccgcccggcggcgggtgaaccgcaaaatgggtttccac
gtcatctacaagactccctgcggcctgagcttgcgcacaatgccggaaattgagcggtac
ctttttgaggtggaatgcagaatgctcttcctggaaatgttttgtttggacccttacgtt
ttggtggatcggaaatttcagcctcagaaacccttttactacatcccagacatcacatat
ggcaaggaagatgttccactttcctgtgtcaatgaaatagacaggaccccacctccacaa
gtggcctacagcaaggagcgcatccctgggaaaggcgtctttattaataccggcgccgag
taccttgtgggatgtgactgcacagatggctgtagggacaaatccaaatgtgcctgtcac
cagctgacaatccaagccacaggctgcactccaggggcacagctgaaccccatggccgga
taccagcacaagcgcttggaagaatgccttcccactggtgtgtacgagtgcaacaagcgg
tgcaaatgcagtgcgaatatgtgcaacaaccgccttgtacaacatgggctccaggtgcgc
ctccaactcttcaaaacccagaacaagggctggggcatccggtgtttggatgatatagcg
aaaggctcctttgtttgcatctatgcaggtaagatcctcacagacgactttgcggacaaa
gagggcctggagatgggggacgagtactttgctaacttggaccacattgaaagtgtcgag
aactataaggaaggctatgagagtgacgccaagtcttcctccgatagcagtggcgtagac
cttaaagacgacgatgaggaaaacactggcagcgaagaccaggacgagtccaatgacagt
tcagatgacaatttcggcaagaacgaggacatcacgaccagctcagtgtggcgcagttac
gccacccgcagacagacacggggccagaaggagaatggaacatcagagactgcttccaag
gactcggctctggccaggcagaccagtcaggatgaaaccacggattgcaaactgccggag
gagacctccaagaacaaggtggcttcctggttaagttcaaacaccatggcggactctctt
atggactctgacagcaggtcttctctaaagatgggagacgcatcagagaccgataaacca
aaggaatcagacgaggccagcaaatacccagggttcggagaaggaaacaggatgtacggt
tacaaccccgccccggccaaaaaagacggtgtgcgacggcctgttagcaaaaccgcgttg
caccagaacaagcgccagtcaaactctgcacagcccactgatgaagtcctgactttatcc
agcagctcggagagtgaggtgggaagtgggaccaacgggaccaaaaaacccgccgctcag
gccacagcgaatgacagcgatgacatccagacaatctcatctgggtctgacgaggaagag
gagaagaagaacgtagctactactgcggggcctgtcaaaagacaagtggctgtaaaatcc
acccgaggattcgccttaaaatccacacacggtatcactgtgaaaaccaacatggcgtcg
ggtgagggtggtaccggacggcggaacacacgacagttctttgatggggaggagtcctgt
tacattattgacgctaaacttgaaggcaacttgggccgatacttgaatcatagctgcagc
cccaacctctttgtacagaatgtgtttgtggatacccatgatctacggttcccttgggtg
gccttctttgccagcaagaggatacgcgccggcacggagctcacctgggattacaattac
gaggtgggaagtgtagaaggaaagaaactgctgtgctgctgcggatccacggaatgtcgt
ggccgtctcttataa

DBGET integrated database retrieval system