KEGG   Xenopus tropicalis (western clawed frog): 100490767Help
Entry
100490767         CDS       T01011                                 

Gene name
atm, at1, atdc, tel1, telo1, xatm
Definition
(RefSeq) ATM serine/threonine kinase
  KO
K04728  serine-protein kinase ATM [EC:2.7.11.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr03440  Homologous recombination
xtr04068  FoxO signaling pathway
xtr04110  Cell cycle
xtr04115  p53 signaling pathway
xtr04210  Apoptosis
xtr04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    100490767 (atm)
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    100490767 (atm)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    100490767 (atm)
   04210 Apoptosis
    100490767 (atm)
   04115 p53 signaling pathway
    100490767 (atm)
   04218 Cellular senescence
    100490767 (atm)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:xtr01001]
    100490767 (atm)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:xtr03032]
    100490767 (atm)
   03400 DNA repair and recombination proteins [BR:xtr03400]
    100490767 (atm)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     100490767 (atm)
Protein kinases [BR:xtr01001]
 Serine/threonine kinases: Other
  PIKK family [OT]
   100490767 (atm)
DNA replication proteins [BR:xtr03032]
 Eukaryotic Type
  DNA Replication Termination Factors
   Other telomere regulation proteins
    Others
     100490767 (atm)
DNA repair and recombination proteins [BR:xtr03400]
 Eukaryotic Type
  Check point factors
   Other check point factors
    100490767 (atm)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3_PI4_kinase FAT TAN FATC HEAT
Motif
Other DBs
NCBI-GeneID: 100490767
NCBI-ProteinID: XP_002934974
Xenbase: XB-GENE-493810
LinkDB All DBs
Position
2
AA seq 3060 aa AA seqDB search
MSLALHELLLCCRQIETDKATERRKEIEKFRRLLRDSETVQQLDQNSDKRQAKQLNWDTV
FRFLQKYVYKEMESIKSAKPSVSQTTQSTRRKKMQDISSVVKDFIRCANKRGPRLKCTEL
LLHVSNTVRDPTTCSAYGADYSSILLKDILSVRKYWCEITSQQWEDLVTLYFSLYLKPES
TVNRLLVSRIIHTLTRGCCQQTDGLHSLFFQFFSKTMKRVRDERNPPGLDQILSALNVFL
TSASGNCRMRVCRLGEDLFLTVLRIWTIQRPKDALKEEIVEFFRLLLRIHHPKGAKTVDE
GAYAFDPDRWKRNLYNLYDTLVNEISQIGSRGKYSSGSRNIAAKENLIELMADICHQLFT
EDTQVLDITQAAFLVTQREPSGAPSKRRRIELGWEVLRDNLQKSHKDFDIIPWLQIATCL
IARYPVSLPSNELTPLLMVLHQLLAQQRRGERAAYVLRCLKEVAVCQKQKTDVKITPKSD
LYKLWSKIWAVTLRSISSPQTEEESFALLGSILQGGLIPADTDFWKIFSGAAAKPSSPGV
HCLAVALTSCCLPEHVSVGFDNPMHEANGTRSSLKEEIIKWLLFGHLDDEMEDTNELSPV
ISKDFSYPALQKILVSLTMKDSRAAMKFFTSLSQCSHIKKENDASFADTEELYLHTSFSE
IPGGPHVGPMDADRNGSSPCLTVNLAIREKLEQDLLTVSEQQLNSYSSEATPPVNLVRCA
CLLTGVLGCYRYADIITEEDALKSNLFQKAKMLMQCAGESTAFLKAKLNEDTKISSLAVL
LTQCVACVCNCAKNSPMWFLTDFFLRLLTPRMLNDLTDISKHLLTNPGGSVEAGEHDLID
DTDSRMETEDQGAVDLFDDHCVAEPAENMEFGELQNVTGAVSPLSEEHLTKPEAVLLQIL
EFLCLCTSTAQNHTVNFRPSDTRRKLLALIDNNALDINKPLHLHVFLQLLNELPKADVPL
PVDEIITLLKPLIEVCSSYRRDQDVCAVILKKLLPVVSCLGQEPMDTEETYDAQEQLLNV
IQAFWILTKDGKYTAVVRASLVNCMKALLEVDPQSKWAILTVDDQDVPVRDIFPAFLADS
HHQVRFHSTVSISRLFQDVNAQALPLQLQQKAFDNVYLKVQEGMRYLSRSSSDPDELPDE
TWNRRSTLLMLISVILRCSPVCEKQALFAICQSVKENGLDPQLIRKELGRVSAALGYRGV
KDFMASHLDYLILEWFRMKVSGYSLSTFPYILLNYSSLKEFYRSCYKVLVPHLVIRSEFE
EVKTLAKCIEEDWKLLLDDCFPRILVNILPYFVSECAADDEEMAQKREVATKVYDLLLDE
SCLGKQQIDNVFSRNLPEIVVELLMTLHETSSSSAREDPDVIQFAGELDPAPNPPYFPSS
VIKATLHYISSCHKSKMKSLVTILSKTPDSFQKILLAICNEAAETNNVYKKHRILTIYHL
FVNLLLLEIKDGLGNAWAFVLRDVIYTIIHHINSRPAPCKMDDVSTRSLLLCLDLLHRVC
QAAVTHCGDALESHLHVIVGSLIPLANSQERIQEKVCDLLNFLVIENKDNANLYHTIKLL
DPFPDIALFKNLRQAHQKTKYSKDPFSLLKEIKNFLSVSICDSLPLTRLEGLNDLRKQLE
QHKDQMKELVRDYQGTPQDSVIARLVVNLLQLSKNAVHQSNGKEVLEAVGSCLGELGPID
FSTIALQHKKDSAYFKADKVFEEKELQCVLVMLTLINNALTDHCIQVRSAAATCLKNILA
TKTGAMFWEACKDKEEPMLLYLQPFRVPKKKFLEVEEIQRAGAMESLDDPCIWIPQNGNH
ESWIKHLTCTLLESGGVKSEVLLLLKPLCEVKADYCQAVVPYLLHNILLNDPNTTWRALL
SKNVQRFFTSCCQSLPTSSRSATPASSDSESDVLARGAIDIASRRTMLSVIEYLRKQRRP
VPGTAFDDNFWLDLNYLEVAMAVQSCAAHFTALLYSEIYADKIKQDGEQRASTNRSNARK
CLKFEEGSQTLDITGLSEKSKEETGISLQDLLMDIYRSIGEPDSLYGCGGGKMLHPLARI
RTYEHEAKWGKALVTYDLEMNLPLVTRQAGIMQALQNFGLSHILSSYLRGLEHENAEWTS
EMQEIHFQAAWRNMQWDDCSQTKNETCGPGYHESLYRAVQSLRDKEFCGFHEHIKYARVK
EVEELCRGSLESVYSLYPALCRLQAIGELASVGEMCSRSITDHGLMDTYLRWQRQSQFLK
DSDFEFLEPVLSLRSVILETLLQEEKKQPSQESLKNILTKHLVDLSRIARSAGNTQLPEK
AMFQIKQHNPSPFGVSEWQLEEAQIFWDKEEPSLARVILKQMINKLELNSFETENDSTLR
LLYAECLRLCGNWLAETCLESPTVIMQNYLEKAVEVAEYPDGAGEKLQEGRMKAFLSLAR
FSDAQYQRIDNYMKSSEFENKQALLRKAKEEVGLMKQHKVQTNRYTVKVQRELELDECAI
LALREDRKRFLCKAVENYISCLVSGEEHDMWIFRLCSLWLENSAVSEVNSMMRQDAQRIP
SHKFLPLMYQLAARMGTKKMGNLGFHDVLNNLIGRISMDHPHHTLFIILALANANKDDQL
MKPEAVKRGRLTKNAPKQISQLDEDRMEAARHIVDTIKKQRTNMVRDVERLCDAYITLAN
MDANQWKSQRNAIPIPSDQPITKLNKLHDVVIPTMEIKVDPSGKYENLVTIVSFKPEFRL
AGGLNLPKIIDCVGSDGKERRQLVKGRDDLRQDAVMQQVFQMCNTLLQRNSETRKRKLTI
RRYKVVPLSQRSGVLEWCTGTVPIGEYLVNEKEGAHKRYRPRDYGSLQCQRKMMEVQRGR
FEEKYQTFLDISENFRPVFRYFCMEKFLDPAMWFEKRLAYTRSVATSSIVGYIVGLGDRH
VQNILIDEESAELVHIDLGVAFEQGKILPTPETVPFRLTRDIVDGMGITGVEGVFRRCCE
KTMEVMRNNQEALLTIVEVLLYDPLFDWTMNPLKALYLQQDEVDFNATLGGDDPECNRNS
CDSQSVNKVAERVLLRLQEKLKGVEEGMVLSVGGQVNHLIQQAMDPKNLSRLFPGWKAWV
NT seq 9183 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcgctctacacgagctgctgctctgctgccgccagatagaaactgacaaggcc
actgaaagaaggaaagaaatagagaagtttcggaggctccttagagattcagagacagtt
cagcagttagatcagaactctgacaagcggcaagctaaacaactcaactgggacacagta
ttcaggtttttgcagaaatatgtctacaaagaaatggaaagcattaaatctgcaaagccc
agtgtttctcagactacacaaagcacccggaggaagaagatgcaagacattagtagcgtg
gtcaaagatttcattcgatgcgcgaataagcgaggcccaaggttaaaatgtactgagctt
ttattgcatgtgagcaacactgtgagagacccaacaacatgttctgcatatggggcagac
tacagcagcatcttgctgaaagatatcctgtctgtccgcaaatattggtgtgagataact
tctcagcaatgggaagacttagtgaccctctacttcagcttgtacctaaaaccagagagc
actgtgaaccgcttgctagtttctagaataattcacactctgaccagaggatgctgccag
cagactgacggactgcactccctgttcttccaatttttttcaaagacaatgaagagagtc
agggatgagagaaacccacctggtctggatcagatcctctctgctctgaatgtgttcctc
accagtgcctcagggaattgccggatgcgagtatgcaggctgggtgaggacctgttcctc
actgtattgcggatctggacaattcaaaggcctaaagatgcactgaaggaggagattgtg
gagtttttcaggttacttcttcgaattcatcatccaaaaggagctaagactgtagatgaa
ggtgcttacgcttttgatccagacagatggaaaaggaacttgtacaacttatatgacaca
ctggtaaatgagatcagccagataggcagcagagggaaatattcttcaggctcccgaaac
attgcagccaaggaaaacttgattgagttgatggctgacatttgtcatcagctattcact
gaagacactcaggtgctggatatcacacaggctgctttcctagtgacccaaagggaacca
tctggagcccccagcaagcgcagaaggattgaacttgggtgggaagtgctacgtgacaac
cttcagaagtcccataaagattttgatatcatcccttggttacaaattgcaacctgcttg
attgcccgatacccagtgagcctgcctagcaatgagctgactccattactgatggttcta
caccagttacttgcccagcagagacgaggcgagagggccgcttatgtgcttcgctgccta
aaagaggttgccgtttgtcaaaagcaaaaaacagacgtgaagatcacaccaaaatcagat
ctgtacaaactgtggtctaaaatctgggctgttacgttgcgtagcatcagttctcctcaa
acagaagaggaaagttttgctttactgggctccatcttacaaggaggtctaataccggct
gacacagatttctggaagattttttcaggagctgctgccaaaccatccagccctggggtt
cattgcttggctgtggccctcacctcatgttgcctcccggagcacgtcagtgtgggtttc
gataatcccatgcatgaagccaatggcactcgaagctctctgaaagaagaaatcataaaa
tggctgttgtttggtcatctggatgatgaaatggaagacaccaatgagctttctcctgtc
ataagcaaggacttctcctaccctgctcttcagaaaattcttgtgagtctgacaatgaag
gactccagagctgctatgaagttcttcacaagcctttctcagtgttcacacatcaaaaag
gaaaatgacgccagttttgcagatacagaagaactatacttacatacctcatttagtgaa
attccgggggggcctcatgtgggtcctatggacgctgacagaaatggaagctctccctgc
ctgactgtgaatttagctataagagagaaactggagcaagacctgctcaccgtctctgag
cagcaacttaactcctactcctctgaggccactccacctgtcaatcttgtccgatgtgcc
tgccttttgactggggtattgggttgttaccggtatgcagatattatcactgaagaggat
gcccttaaatccaatttatttcaaaaagccaagatgctgatgcagtgtgctggggagagc
actgcattcctgaaggcaaaactgaatgaggataccaagatcagttccttggcagtgctg
ttaactcagtgtgtggcctgtgtatgtaactgtgcaaagaacagtcccatgtggttcctc
acagattttttcctacgtcttttaaccccaagaatgttaaatgacttgacagacatcagt
aaacatttacttaccaaccctggaggatcggtggaggccggtgagcatgatttaatagat
gatacagattccagaatggagacagaagaccagggagctgtggacttgtttgatgatcat
tgtgttgctgaaccagctgaaaacatggagtttggggagcttcagaatgttactggagca
gtgagccccctgtcggaggaacatctcaccaagccggaggctgtcctgctgcagatcctg
gagttcctttgcctttgtacatctactgctcagaatcacacagtcaacttccgaccttca
gatacccgcagaaagctattagccctgattgataacaatgctctggacattaacaagccg
ctgcaccttcatgtgttcttacagctcttaaatgagctgcccaaagctgatgtgccactg
cctgttgatgaaattataacgttgctgaagccacttattgaagtgtgttcttcctatcgc
cgagaccaggatgtctgtgcggttatactaaaaaagctgctccccgtggtcagctgtcta
gggcaggaaccaatggacacagaagaaacatatgatgctcaggagcaactcctgaatgtt
attcaggcattttggattttaacaaaagatggaaaatacactgccgtggtccgtgcctct
ctggtgaattgcatgaaggccctgctagaggttgaccctcagtctaagtgggctattctt
acagttgatgaccaggatgttcctgtgagagacattttccctgcatttctggctgactct
catcaccaagtccgctttcattctacagtgtccataagcagattgttccaggatgtaaac
gcacaagcccttcctctacagctacagcagaaggcatttgataacgtttacctgaaggtt
caagaaggaatgcgctatctgtctcgtagcagctctgacccagatgagctccctgatgaa
acctggaaccgaagatctacgttgctgatgttgatatcggtgattcttcgctgtagccca
gtgtgtgagaagcaggctctgtttgccatctgtcagtctgtgaaagagaatgggctggac
cctcagcttatcagaaaggagctgggcagggtttctgctgctctgggatacagaggagta
aaggactttatggcttctcatttagactatctgatccttgagtggtttcgaatgaaggtt
tctgggtacagtctctcaacattcccatacatcttgctaaattactcctctctaaaggag
ttttacagatcttgttacaaagttcttgtcccccatctggtgataaggagtgaatttgaa
gaggtgaagacccttgctaagtgcattgaggaggactggaagcttctgcttgatgattgc
tttcccagaattctagtgaacatcctcccctactttgtctccgaatgtgctgctgatgat
gaagagatggcacaaaagagagaggttgctactaaagtatatgacttgctgctagatgaa
agctgtttgggcaagcagcaaatcgacaacgtgttctcccgaaatcttccagagattgtg
gtggagctgctgatgacactgcatgaaacttccagcagcagcgccagagaggaccctgat
gtgatacagtttgcaggggaactggatccagccccaaaccccccttattttccatcatct
gttatcaaggcaacattgcactacatcagcagctgccacaaaagcaaaatgaaaagtctg
gtaacaatattgtccaagaccccggattcatttcagaagatattgctggctatatgcaat
gaggctgcggaaacaaacaatgtgtacaagaagcaccgcattctcactatctatcacctg
tttgttaatctgctacttctggaaataaaagatggtctgggcaatgcttgggcatttgtt
ctaagggacgtcatctacaccataatccatcacatcaacagcagacctgctccctgcaaa
atggatgatgtgtctacgcgcagtctcttgctttgcctcgaccttttgcaccgagtttgc
caagcagctgtcactcactgcggagatgctttagagagtcacctccatgtcattgtgggc
agtctcatacctttggcaaacagtcaggaaagaattcaagaaaaggtgtgcgacttgctg
aacttcctggtgatagagaacaaggacaatgcgaatctctatcataccattaaacttctg
gatcccttccctgacatagctctttttaagaacctgcgtcaggcccatcaaaaaaccaag
tacagcaaagacccattctcccttctaaaggaaattaagaattttctctctgtcagcatc
tgtgattcccttcccctgaccagactagaaggactcaatgacctgaggaaacagttagag
caacataaggatcagatgaaggagcttgtgagagattaccaaggaaccccccaggacagt
gttatagcaaggctagtagtgaatctgttacagctctccaagaatgcagtgcatcagtct
aatgggaaagaggttctagaagctgttggcagttgccttggagaattaggacctattgac
ttctccaccatcgctctccagcacaaaaaagattctgcctatttcaaagcagacaaagtc
tttgaagaaaaagagcttcagtgcgtcctggtcatgctgacattaataaataatgccctg
acggatcactgcatccaggttcggtcggcagctgctacctgcttaaaaaacattctggcc
acaaaaactggcgctatgttttgggaggcctgtaaagacaaagaggaaccaatgcttctc
tacctccagcctttccgtgttccgaagaaaaaatttctggaagtggaagaaattcagaga
gctggtgctatggaaagcctggatgacccctgtatctggatccctcagaacggaaaccat
gagagttggataaaacatctgacttgcactttgctggagagcggtggggtgaagagtgaa
gttctgctcctattaaagcctttatgtgaggtgaaagcagattactgtcaggcagtggtg
ccttatcttctacataacattcttctaaatgaccccaataccacgtggagggctcttctc
tcaaagaacgtccagaggtttttcacctcatgttgccaatctctgccaacgtcaagtaga
tcagctactccagcaagttcagattcagaatcggacgtgctggcgcgtggggccatagac
attgcttccaggaggacgatgctatctgtgatcgaatacttgcgcaaacaaaggaggccg
gtgcctggaacagcttttgatgacaatttctggttggacttaaactacctcgaagtggca
atggctgtccagtcctgtgccgcacacttcactgctttactctactccgaaatctatgcc
gataagatcaaacaggatggtgaacagcgagcaagtacaaacaggtccaatgcacgcaaa
tgcctgaaatttgaagagggtagtcagacattggatattactggcctgagtgagaaaagc
aaagaggagactgggataagcttacaggacctgttgatggatatctataggagcattggg
gagcctgacagcttgtatggctgcggtggtggaaaaatgctccatcctcttgcaagaatc
cgcacttatgaacatgaggctaaatggggaaaagcattggtgacctatgacctggaaatg
aacctccctctggttacccgccaggcagggattatgcaggctttacagaactttgggctc
tcccatatactttcttcttatttacgaggactcgaacatgaaaatgcagaatggacctca
gaaatgcaggaaatccatttccaggctgcctggaggaacatgcagtgggacgactgctca
cagacaaagaacgagacctgtggacctggttaccatgaatcgctctatcgggccgtacag
tcactgagggacaaggaattctgtggctttcatgagcatataaaatacgccagggttaag
gaggtggaagagctgtgccggggcagcctggaatctgtgtactctctctaccctgcgctg
tgtcggctacaagctatcggggagcttgcaagtgtgggggagatgtgctccaggtccatc
actgaccatgggttaatggatacttacttgaggtggcagaggcaatcccagtttctaaaa
gacagtgattttgaattccttgagcccgtcctgtccctacggtctgtgattctggaaacg
ctgctacaggaggagaagaagcaacccagccaggagtccctgaagaacatcctaactaag
cacctggtggatttatctagaatagcccggagcgctggaaacacacagcttccagagaaa
gccatgttccagatcaagcagcataaccccagtccgtttggtgtgtctgagtggcagctc
gaagaggctcagatcttctgggataaagaggagccaagcctagcgcgggtgatactcaag
caaatgattaataagctggaattaaacagctttgagactgagaatgattccacccttcgc
ttgctctatgccgagtgtctgaggttatgtggaaactggctggcagagacctgcttggag
agtcccacagtcatcatgcagaattatctagaaaaggctgtggaagttgctgagtaccct
gatggggccggagagaagctgcaggagggcagaatgaaggccttcctgtctctagctcgc
ttttctgatgcccagtatcagaggattgacaactacatgaagtcctctgagtttgagaac
aaacaggccttgctgagaaaagccaaggaggaagttggtctaatgaagcagcacaaggtt
cagaccaataggtacacggtgaaggtgcagcgagagctggagctggatgaatgtgccatc
ctggcgctgagggaggacagaaagcggttcttgtgcaaagcagtagagaactacatcagc
tgcctcgtttctggagaggaacacgacatgtggatcttccgcctttgctccctctggctt
gagaattccgcagtgtcggaagtgaacagtatgatgaggcaagatgcccagaggatccca
tcccacaaattcctgcctctgatgtaccaactggctgctcgtatgggcaccaagaagatg
ggaaacctgggatttcatgacgtccttaataatctgattggtcggatttcaatggaccac
ccacatcacacgctgtttattatcctggctctggccaatgcaaacaaagacgatcagctg
atgaaaccggaggctgtgaaacggggccggctcaccaagaatgcccccaaacagatctcc
cagctagatgaggatcgcatggaagccgcgcgccacatcgtcgataccataaaaaagcag
aggactaacatggtgcgagatgtggagagactctgtgatgcctatataacccttgccaac
atggatgccaaccagtggaaatcccagagaaatgccatccccatcccatcagaccaaccc
atcactaaactgaataaactgcatgacgttgtgattccaactatggaaatcaaggttgac
cccagtgggaagtatgaaaacctggtgacaatcgtatcttttaaacctgagttccgcctg
gccgggggccttaatctgccgaagataattgactgtgtcggctccgatgggaaagagagg
agacagcttgtcaagggcagagatgacctgaggcaagatgcagtcatgcagcaagtgttc
cagatgtgcaacacattattgcagcgcaacagcgagacgaggaaaagaaagctgactatc
cgcagatacaaggtcgtccccttgtcccagagaagtggcgtgctcgagtggtgcacgggg
acagttccgattggggaataccttgtcaatgagaaagaaggtgcacacaagcgttaccgc
ccaagggattatggcagcttacagtgccaaaggaaaatgatggaggtgcagagaggacgc
ttcgaagagaagtaccagacatttctcgacatttccgagaacttccgcccagtctttcgc
tacttctgcatggagaagtttctggatcctgccatgtggtttgagaaacgtttagcatac
actcgcagtgtggccacatcctccatagtcggctacattgttgggctcggagacagacat
gtccagaacatccttatagatgaggagagcgctgaactcgtacacattgacttaggagtg
gctttcgagcagggtaagattctgcctacaccagaaactgttcccttccggctcacaaga
gatatcgtggatggtatgggcatcactggagttgaaggggtttttagaaggtgctgtgag
aagaccatggaagtcatgaggaacaaccaagaagctcttctgaccattgttgaggtttta
ctctatgacccgctctttgattggacaatgaatccccttaaagctctgtacctgcaacag
gatgaagtggatttcaatgccacccttggtggtgatgacccagaatgcaacagaaattca
tgtgacagccagagcgtcaataaagtggcagagcgtgttctcctgcgccttcaggaaaag
ctgaaaggagtggaagaggggatggttctgagtgtagggggacaagtcaatcatctcatc
cagcaggcaatggacccaaagaatctcagtaggctgttccctggctggaaggcttgggtg
tag

DBGET integrated database retrieval system