KEGG   Xenopus tropicalis (western clawed frog): 100491279Help
Entry
100491279         CDS       T01011                                 

Gene name
f13a1
Definition
(RefSeq) coagulation factor XIII, A1 polypeptide
  KO
K03917  coagulation factor XIII A1 polypeptide [EC:2.3.2.13]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.13  protein-glutamine gamma-glutamyltransferase
     100491279 (f13a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Transglut_N Transglut_C Transglut_core DUF3126
Motif
Other DBs
NCBI-GeneID: 100491279
NCBI-ProteinID: XP_002936471
Xenbase: XB-GENE-1004150
LinkDB All DBs
Position
6
AA seq 738 aa AA seqDB search
MSETKKEKKKSSVPGHTGRSSLPPNVSNADEDEVPTMETFGVIPRGVSMKDYLEVQNIHL
FKQTNEKNKREHHTDRYYNNKLIIRRGQTFDIQIDFNRNYNPEKDQFWIEYVIGRYPQQS
KGTYIPIPIVDKLEAGKWGAQVTRNEYNSVSVTILSAPDCIVGKFRMYVAVLTPYGIMRT
SRNSETDTYILFNPWCKEDSVYMDDEREIEEYVMNDVGIIFHGEVSNIKKRSWEYGQFEE
QILDACLNLMDRAQLDLSGRGNPIKISRVGSAVINSKDDDGVVAGNWKNDYSFGVSPSAW
TGSVDILLEYHSSGLPVKYGQCWVFAGVFNTFLRCLGIPARLITNYFSAHDNDANLRTDV
YLDEDGKTNTTLTKDSIWNYHCWNEAWMTRSDLPVGFGGWQAVDATPQETSDGMFRCGPA
SVQAIKHGHACFQFDTPFIFSEVNSDIVYSRAMKDGSKVIEHIDKTHVGQKILTKQIGGD
DPQDITDLYKFSEGTEEERLALEAALMYGVKKEIRDEDQQQFAPDTDMDFQADNAVFGSD
FKVTLTFKNWSANLYTVSAFLTGHIVFYTGVLKSEFKNKNVEVTLDPSSSKSVEVLIKAH
EYLSKLVEQASLHFFVTARINETKKIMAKQKIVILKVPELHIKVLGEKMVGKEMTIVIEF
TNPLKKALQNVALRLGGPGLMRTRAKVFGEIPMNSSLTWEQKCIPQRAGTRKLIATLDCE
TIRHVYGELELEVLDNPL
NT seq 2217 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaaacaaaaaaggagaagaaaaagtcttcagttccaggtcacacagggcgtagt
tctctcccaccaaatgtctctaatgcagatgaagatgaggttcccaccatggaaaccttt
ggtgtcattccaaggggtgttagcatgaaagattatctagaagtccaaaatattcatctg
ttcaagcagaccaatgaaaagaataagcgggaacatcacactgatagatattacaataac
aaactcatcatacgccgtggccagacctttgacatccagatagactttaaccggaattat
aatccggaaaaagaccagttttggatagaatatgttataggtcgttatccccagcagagt
aaaggaacatacataccgatccccattgttgacaaactggaagcaggaaaatggggagca
caagttactcggaatgagtacaattcggtcagcgtgaccatactatcagcaccggactgc
attgttggcaagttccgcatgtatgtggctgtcctaactccttatgggattatgcgcacc
tccagaaattcagagacagatacctacattctcttcaacccatggtgcaaagaggattct
gtttatatggatgatgagagggaaattgaagaatatgtcatgaatgatgttggaattatt
ttccatggagaagtgagcaatatcaagaaaagaagttgggaatacgggcagtttgaagaa
cagattcttgatgcatgccttaaccttatggacagagctcaactggatctcagtggacgt
gggaacccaattaaaattagtcgtgttggatctgcagtgataaattccaaagatgatgat
ggtgttgttgctgggaactggaaaaacgattattcttttggagtgtctccatctgcttgg
acaggaagtgtagatatcctgttggagtaccacagttctggccttccggtgaaatatggt
cagtgctgggtctttgctggtgtgttcaatacatttttgcgatgcctgggaatacctgca
cgacttatcaccaattatttctcagctcatgacaatgatgccaatctacgtacggatgtc
taccttgacgaggatgggaaaacaaacactacactcacaaaggattctatctggaattat
cattgctggaatgaggcttggatgactcgatctgatcttcctgttgggtttggaggatgg
caagctgtagatgctacaccacaggaaaccagtgatggtatgtttcgatgtggacctgca
tcagttcaagccattaagcatggtcacgcctgcttccagtttgatacaccatttattttt
agtgaggtaaacagtgacatagtatactctagagcaatgaaagatggatccaaagttatt
gaacatattgacaaaacacatgtgggacagaagatattgacaaaacaaattggtggagat
gacccacaagatataactgacctgtataagttttctgaaggcacagaggaggagagactg
gctctagaggcagccctgatgtacggagtcaaaaaggaaatcagagatgaggatcagcaa
cagtttgctcccgacacagatatggactttcaggcagataatgcagtatttggcagtgac
ttcaaagtcactttaactttcaagaactggagtgccaatctttatacagtatccgctttt
ctcaccggacatattgtcttctacaccggggtcctgaagtctgagttcaagaataagaat
gtagaagtgacattggacccttcatcctctaaatctgtggaagttctaataaaagcccac
gagtacttgagcaagcttgtggaacaggcctccttacatttttttgtcacggctcgtatt
aatgaaacaaagaagataatggcaaaacagaagattgtgatactgaaagttcctgagcta
cacatcaaggttcttggagagaagatggttggcaaagaaatgactattgtgattgagttc
actaatccattaaagaaggcacttcaaaatgttgctttgcgtctcggaggacctggactt
atgaggacaagagctaaagtttttggggaaattccaatgaattcatcattgacttgggaa
cagaaatgcataccacaaagagcaggcacaaggaaattaattgctacgctagattgtgag
acaatacgacatgtttatggagagctagagcttgaagtgttggataatcctctgtga

DBGET integrated database retrieval system