KEGG   Xenopus tropicalis (western clawed frog): 100492275Help
Entry
100492275         CDS       T01011                                 

Gene name
flvcr1
Definition
(RefSeq) feline leukemia virus subgroup C cellular receptor 1
  KO
K08220  MFS transporter, FLVCR family, feline leukemia virus subgroup C receptor-related protein
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100492275 (flvcr1)
Transporters [BR:xtr02000]
 Solute Carrier Family (SLC)
  SLC49: FLVCR-related transporter
   100492275 (flvcr1)
 Major Facilitator Superfamily (MFS)
  Protein transporters
   Feline leukemia virus subgroup C receptor (FLVCR) [TC:2.A.1.28]
    100492275 (flvcr1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MFS_1
Motif
Other DBs
NCBI-GeneID: 100492275
NCBI-ProteinID: XP_002934732
Xenbase: XB-GENE-6050557
LinkDB All DBs
Position
5
AA seq 511 aa AA seqDB search
MVSPEVTQHHNGHILEKEDVPAPVSNGDLQVSVIELPRSPDTELPPQQAERQAMLPGQPL
ETRLYRRRFLILAVFSLYSLVNAYQWIQYSIITSIFTQFYQVTSDKIDWLSVVYMVAYVP
LIFPATWLLDKKGLRITALLGSGLNCLGAWLKCASVRPDLFGVTMFAQTVCSVAQVFILG
LPSQVASVWFGPKEVSTACATAVLGNQLGTAIGFLLPPVLVPKVDDDVELTGHNISIMFY
GTAVVSTLLFILTIAVFKEKPKIPPSQSQALLQDEATEDYSYKISIMNLFRNVPFVLLLI
SYGIMTGSFYSVSTLLNQMITFHYPDEEVNAGRIGLTLVLAGMVGSIICGLWLDYSKTYK
QTTLIVYILSFIGMLVFTFTLDLDNLVVVFVTGGVLGFFMTGYLPLGFEFAVEITYPESE
GTSSGLLNASAQIFGILFTLAQGKLTTDYNPQAGNIFLCAWMFVGIILTALIRSDLKRHN
INAGITKSELKSVPVQEEGLTIGSTQSSSAV
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtgtctccggaggtaacgcagcatcacaatgggcacattctggagaaggaggacgtc
ccggcgcctgtcagcaatggggacctgcaagtcagcgtgattgagctcccccgcagcccg
gacaccgagctgcctccccagcaggcagagagacaggccatgctgcccgggcagcccctg
gagacccggctgtaccgcaggaggttcctcatcctggcagtgttcagcctctattcgctg
gtcaatgcctaccaatggatccagtacagcatcatcacctccatcttcacccagttctac
caggtcaccagcgacaagatcgactggctctctgtggtctacatggtggcctatgtgccc
ctcatcttcccagccacctggctactggacaagaaggggctcaggatcaccgccctgctg
ggctcagggctcaactgcctgggagcttggctcaaatgtgccagcgtccggccggacctc
ttcggggtcaccatgtttgcccagacggtttgctcggtggcccaagtctttatcctgggc
ttgccctctcaggtggcatcggtgtggtttggccctaaggaggtatccacagcctgtgcc
acggcggtactgggcaaccagcttggaaccgctattggatttcttctacctcctgtgtta
gtcccaaaggtcgacgatgatgtggaacttactggacacaacatcagcattatgttctat
ggtacagctgttgtctccacgttgctcttcatattgactatagcagttttcaaggagaag
ccaaagattcctccgagccagtcccaagcgcttctgcaagatgaggctactgaggattat
tcctacaagatttccataatgaacctcttcaggaacgttccatttgttctcctgctaatt
agctatggcatcatgactggatccttctattctgtatccacgctgctaaaccaaatgatc
acgtttcattatccggatgaagaagtgaacgctggaaggatcggcctaacgcttgtactg
gcaggcatggttggctccatcatttgtggtctgtggttggattattccaaaacatacaaa
caaacgacgctgattgtttacatcctgtcattcatcggaatgctggttttcaccttcacg
ctggaccttgataacctcgtggtggtgtttgtgacaggcggggttcttgggttctttatg
actgggtatctgccgcttggtttcgagtttgctgtggagataacgtacccagaatcagaa
gggacctcatcagggcttctaaatgcctctgcccagatatttgggattttattcacatta
gcccaagggaaactgactacagactacaatccacaagctgggaacatctttctgtgcgcc
tggatgtttgtgggtatcatactaacagctctgatcagatccgacctcaaaagacataat
ataaatgcgggaatcacaaagtcagaattgaaatctgtccctgtgcaggaagaaggttta
accattggaagcacccagtcctcctctgccgtctga

DBGET integrated database retrieval system