KEGG   Xenopus tropicalis (western clawed frog): 100494698
Entry
100494698         CDS       T01011                                 

Gene name
nos2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00220  Arginine biosynthesis
xtr00330  Arginine and proline metabolism
xtr01100  Metabolic pathways
xtr04020  Calcium signaling pathway
xtr04146  Peroxisome
xtr04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    100494698 (nos2)
   00330 Arginine and proline metabolism
    100494698 (nos2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    100494698 (nos2)
   04020 Calcium signaling pathway
    100494698 (nos2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    100494698 (nos2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     100494698 (nos2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 Rcd1
Other DBs
NCBI-GeneID: 100494698
NCBI-ProteinID: XP_002935342
Xenbase: XB-GENE-485093
LinkDB
Position
2
AA seq 1160 aa
MMCPWKRFMKIGTVKEKAFCNEMDINNNLHKDFEKKHSTIIKEANNFNGTKQTMAELKSV
SEKRFPENITHPQKRETCPKYLKLKNYESGSILQDTLHLKAKKNLSCQSKICQGSIMNPK
VYIRGPRNEPVPQDELLPQAIEFVNQYYSSFKEPQIENHLNRLETVAKEIECTGTYQLTR
DELAYATKMAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFELLCRHITYSSNGGNIRSA
ITIFPQRTDGKHDFRVWNSQLIRYAGFQMPDGSIVGDPASIEFTELCIHLGWKPKYSRFE
ILPLVLQANGQDPELFEIPLDIIDEVPIEHPKYEWFKELSLKWYTLPAVANMLLEVGGLE
FSACPFNGWYMGTEIGVRDFCDVQRYNILEEVGRRLGLETHKLASLWKDQAVIELNIAVL
YSFQKHNVTIMDHHSAAESFMKHLENEYRLRGGCPADWVWLVPPMSGSITPVFHQEMLNY
ILSPFYYYQIDAWKTHVWQDENRKPKKKEFKFSVVAKSVLFASSLLKKTVAARTKVTILY
ATETGKSETFAKKLQALFSYAFNAKVLCMDDYNIRNLEDESLLLVVTSTFGNGDCPGNGE
KFKKAMFSCKYLKNKLRYAVFGLGSSMYPQFCAFAHTVDQRLAQLGAAQISLTGEGDELS
GQEESFLNWAVQTFKAACELFKIRDRRNIHLPKCYTSTESWSAENYRLVNDNQQYDHIKA
LCKMHSRSIVPMKLKFRKNLQSPKSSRTTLLVKLSYENSQEVRFMPGEHAGLFAGNQPEL
VASVISHLKDAPPCNQHVRLETRNEQESFWTISEKIPPCSLTQALTYFLDITTPPTQLLL
KKLSLLATKVTDKSRLEELSKDADEYKQWKNHNFPNFLEVLEEFPSLQVPTTFVLTQLPP
LKPRYYSISSSRDMVPGEIHLTVAVVNYTTRGGQGPLHHGVCSTWLNDLDINETVPCFIR
STNTFHLPENPSVPCVLIGPGTGISPFRGFWQQRLYDLEKKGIKAGSMILLFGCQQSGMD
EIYADETQYMKSKGVLKDVYTAYSRQPGQAKVYVQDILIKNLESEVCRILLEEEGHLYVC
GNFEMAKNVAQTLKSMIAKRLKLNEEEAENYFSELKNKLRYHEDIFGPAHRPQQSTNGYP
SPVAFSTPVYTPHHRITNMK
NT seq 3483 nt   +upstreamnt  +downstreamnt
atgatgtgcccctggaaacgattcatgaagatcggaactgtaaaagagaaagcattttgc
aatgaaatggacatcaacaacaatctgcataaggactttgagaaaaaacacagcacaatc
ataaaagaagcaaacaatttcaatggcacgaagcaaacaatggctgaacttaaatctgta
tcagagaaaagatttccagaaaacatcacgcacccgcagaaaagagagacttgtcctaaa
tatttgaaactgaagaattatgaaagtggatcaattcttcaagacactttacacctcaaa
gcaaagaagaacctcagctgccagtctaaaatatgtcagggatccatcatgaacccaaag
gtgtatataagaggccccaggaatgagccagtaccacaagatgaacttttacctcaagca
atagaatttgttaaccagtactacagctccttcaaagagcctcaaatagaaaatcacctt
aacaggctggaaacagtggccaaagaaatagaatgtactggcacctaccagctaactaga
gatgagcttgcctatgcaaccaagatggcatggagaaatgcaccacgctgcattggacga
atacagtggtctaacttacaggtctttgatgctcgtgactgcaagacagccaaggaaatg
tttgaactcctctgccgtcatataacttactcatcaaatggaggaaacataagatctgct
attaccatatttcctcagaggactgatgggaaacatgatttcagagtgtggaacagtcaa
cttattcgttatgcaggttttcaaatgccagatggatcaatcgttggtgacccagccagc
atagaatttacagagttgtgtatccatcttggttggaagccaaaatacagtcggtttgag
atccttcctttggtgcttcaggcaaatggccaagatccagagttgtttgagataccatta
gatattattgatgaggtgccaatagaacatccaaagtatgagtggttcaaggaacttagc
ctgaagtggtatacattgcctgcagttgccaatatgcttcttgaagttggaggtttagag
ttctctgcttgccccttcaatggctggtacatgggaacagaaattggtgttcgggatttt
tgtgatgtccagcgctataatattcttgaggaagtaggaaggcgactgggcttggagaca
cacaaactggcctcattgtggaaagaccaagctgttattgagctcaacattgcagttctg
tatagttttcagaaacacaacgtgactatcatggaccaccactctgctgcggagtccttt
atgaagcatctggagaatgagtacagactgcgaggaggttgcccagctgattgggtttgg
ctcgtccccccaatgtcaggcagcatcacgccagtgtttcaccaggaaatgctgaattac
attctgagccccttttattactatcagatcgatgcttggaaaactcatgtgtggcaggat
gaaaaccgcaaaccaaagaagaaggaatttaagtttagtgttgtggcaaagtctgtgcta
tttgcctcatcactcttaaagaaaactgtggctgccagaaccaaagttaccattctctat
gcaacagaaacagggaaatcagaaacctttgcaaagaaactgcaagcactctttagttac
gccttcaatgccaaggttctctgtatggatgactataacatcagaaacttggaggatgaa
agccttctattggttgtgacgagcactttcggaaatggagactgcccaggaaatggagag
aaattcaagaaagcaatgttttcctgcaaatatctaaagaacaaattaaggtatgctgtt
tttggccttggatccagcatgtatccgcagttctgtgcatttgcccatacagtggaccaa
aggctggcacaactcggtgccgcacaaatcagccttacaggtgaaggagatgagctcagt
gggcaagaagagtcttttctaaactgggcagttcagacatttaaggctgcatgtgaacta
tttaaaattcgagacagaagaaatattcatttacctaagtgttacacctcaacagaaagc
tggagtgcagaaaattatcgtcttgttaatgataaccaacaatatgaccacatcaaagct
ctctgtaaaatgcactccaggagcatagtgccaatgaaactgaaatttaggaagaacttg
caaagtcccaaatcaagccgtaccacactgcttgtaaagctttcctatgagaatagccag
gaagtacggtttatgccaggagaacatgctggtttgtttgctggcaaccagccagagcta
gtagcgagcgtaattagccatctgaaggatgctccgccctgtaatcagcatgtccgactg
gagacacggaatgagcaggagagcttctggacaatcagtgaaaaaatccctccctgctct
ttgacacaagcactgacatatttcctagacatcactacgccaccgacgcagcttctgcta
aaaaaactctccctgttggccaccaaggtcacggataaaagcaggctggaagagttaagc
aaagatgcagatgaatataaacagtggaagaaccataactttcctaatttcctggaggta
ctggaagagttcccatccctacaagtacctacaacgtttgtgctcactcagctcccacct
ctgaagcctagatactactctatcagctcctctcgtgatatggtgccgggggagatccac
cttactgttgctgttgtgaattacacaaccagaggtggccagggcccattacatcatggt
gtctgcagcacatggctaaatgatctagatatcaatgaaacagttccatgctttattagg
agtacaaacacattccatctcccagaaaacccatcagttccatgtgtactgattggccca
ggaacaggaatttctccattcagaggattttggcagcagcgactctatgacctagaaaag
aaaggaattaaggctgggtctatgatcctactgtttggctgccagcaatcagggatggat
gaaatctatgcggatgagacacaatacatgaagagtaaaggcgtgctgaaagatgtgtac
actgcatattcaaggcaaccaggacaagccaaggtgtatgtgcaagatatacttataaag
aacttggagagtgaagtgtgtcggattttgcttgaagaagaaggccatctgtatgtgtgc
gggaactttgaaatggcaaagaatgttgctcagaccctaaaaagcatgattgcaaagagg
ctgaaactgaatgaggaagaagccgagaattatttctctgagttgaagaacaaattaaga
tatcacgaagatatatttgggcctgctcataggcctcagcagtctacaaatggataccct
tctcctgtggcttttagtacaccagtctatactccacaccatagaattacaaatatgaag
tag

DBGET integrated database retrieval system