KEGG   Xenopus tropicalis (western clawed frog): 100494862Help
Entry
100494862         CDS       T01011                                 

Definition
(RefSeq) transmembrane protease serine 2-like
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     100494862
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   100494862
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 Ldl_recept_a Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 100494862
NCBI-ProteinID: XP_017947270
LinkDB All DBs
Position
2
AA seq 540 aa AA seqDB search
MEPNVYVVPAPPACSAQVPAGQFVAPPPIGPFRWSLTTTTPSPCQMYCSYTYTCIHAYQI
CNGVQDCAYGDDERNCATTTPSPCQMYCSYTYTCIHAYQICNGVQDCAYGDDERNCATTT
PSTPTCQMYCSYTYTCIHAYQICNGVQDCLYGDDELNCVTTPFCEKRCGSSVSCVLSSQW
CDGVSQCPNGEDETSCVRLYGADSQLQVYSTLKSAWLPVCADNWNDTYGRFACQDFGFNG
SSYNRYNTLMSPYSPVGYFKLYNGNWTNRFYTSVQNSSFCLSGNVVSLHCISCGVSNNSV
TSRIVGGTYANLGNWPWQVSLQYMARVLCGGSIISPRWIVTAAHCVYGSYSSAPGWKVFA
GTLTLPSYYDPSGYSVERIIAHPGYNSSTNDNDIALMELSNELTFGYSIQPVCLPNSGMF
WEAGTTNWISGWGSTYEGGSASTYLRYAAVPLIDSNVCNKTYAYNGQITASMICAGYLSG
GVDTCQGDSGGPLVTQTNATWWLVGDTSWGYGCARAYKPGVYGNMTTFLDWIYLQMRTYS
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggaacccaatgtgtatgtcgtcccggcaccgccagcctgcagtgcccaagtacctgct
ggccagtttgtagctccgcctccaataggaccatttcgctggagtcttaccactacaacc
ccaagcccctgccagatgtactgcagctacacatacacgtgtatccatgcctaccagata
tgtaatggggtacaggactgcgcttatggggatgatgaaagaaattgcgccactacaacc
ccaagcccctgccagatgtactgcagctacacatacacgtgtatccatgcctaccagata
tgtaatggggtacaggactgcgcttatggggatgatgaaagaaattgtgccactacaacc
ccaagcaccccgacctgccagatgtactgcagctacacatacacgtgtatccatgcctac
cagatatgtaatggggtacaggactgcctttatggggatgatgaattaaattgtgttaca
acgccattttgtgaaaagagatgcggctcatcagtaagttgtgtcctgtcttcccaatgg
tgtgatggggtgtcccagtgccctaatggggaagatgagacctcctgtgtgcgattatat
ggagcagactcccaactgcaggtctattctacattaaagtcagcatggctgcctgtgtgc
gctgataactggaatgatacctatgggaggtttgcctgccaggactttggattcaatggg
agcagctataacagatataacactttgatgtccccatattcccctgttgggtatttcaag
ttatacaatggaaactggacaaacagattctatacaagtgttcaaaacagttctttttgt
ttatcgggaaatgtggtctccttacattgtatcagctgtggtgtatctaacaacagtgta
accagccgaatagtaggaggaacttatgccaacttgggaaactggccgtggcaagtcagt
ctacagtacatggcaagagttttatgtggtgggtccatcatttctcccaggtggatagtg
acggcagctcactgtgtatatgggtcttactcaagtgctcctggatggaaggtgttcgct
gggacactgaccctgccaagttactatgatcccagtggatattccgtggaaagaataatt
gcgcaccctggttataattcttccactaatgataatgatatcgccctaatggaactaagc
aatgagttaacatttggctatagcattcagccggtgtgcttacccaactctggaatgttc
tgggaggctggaactacaaattggatatctggttggggatcgacctatgaaggaggtagc
gcttctacatatctgcggtatgctgcagttccactgattgactcaaatgtgtgcaataaa
acttatgcgtacaatgggcaaattacagcttctatgatatgtgctggctatcttagtggg
ggagtagatacatgccagggtgacagcgggggacctttagtgacccaaacaaacgccact
tggtggcttgttggtgacaccagctggggatatggctgtgcccgagcctataaacctggt
gtatatgggaatatgacaacgttcttggattggatatatttacagatgaggacctacagt
tga

DBGET integrated database retrieval system