KEGG   Xenopus tropicalis (western clawed frog): 100495955Help
Entry
100495955         CDS       T01011                                 

Gene name
gaa, lyag
Definition
(RefSeq) glucosidase, alpha; acid
  KO
K12316  lysosomal alpha-glucosidase [EC:3.2.1.20]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00052  Galactose metabolism
xtr00500  Starch and sucrose metabolism
xtr01100  Metabolic pathways
xtr04142  Lysosome
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    100495955 (gaa)
   00500 Starch and sucrose metabolism
    100495955 (gaa)
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    100495955 (gaa)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    100495955 (gaa)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     100495955 (gaa)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   100495955 (gaa)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2 Trefoil Nucleoside_tran
Motif
Other DBs
NCBI-GeneID: 100495955
NCBI-ProteinID: XP_002932561
Xenbase: XB-GENE-6054131
LinkDB All DBs
Position
10
AA seq 896 aa AA seqDB search
MSMQGSMGRRSSADSVCSLLMLILISAVCPVAPSQETGPSPLQCSVSPNRRFDCVPEKCV
SKEECEARGCCYSPAGDKGNIGQPWCFFPPSYPSYKMFNLTQTDRGYNATLKRSVGTFMP
HDIMTLQLEVLFETESRLHFTIKDPAKKRYEVPIPTPQVSGKASSTLFDVQFSCDPFGLI
IRRKSSGLILLNTTVAPLIFADQFLQISTSLPSGYLYGLGEHLTALNLSLQWNRLTFWNR
DLRPSKDSNLYGSHPFYLSMEEGGQSHGVFLLNSNAMDVLLQEAPALTWRTTGGILDFYV
FLGPEPKSVIRQYQDIIGYPFMPPYWSLGFHLCRWGYSTSNCTRQVVKNMRDAKIPLDVQ
WNDIDYMDAMRDFTYDQNRFGDFPEMVKEFHQQGVKYIMILDPAISSSNTPGSYPPYDDG
LKRGVFITDDEGKPLVGKVWPGLTVFPDFTMPETFSWWYDMVKLFHDQVPFDGIWIDMNE
PSNFVQGSVDGCPNNELENPPYVPGVVGGSLRSTTICASSQQHLSSHYNLHNLYGLSEAV
ATHYALVKILKKRPFIISRSTFASHGHYAGHWTGDVVSSWEQIYYSVPAILLFNMFGVPM
VGADICGFGGNTTEELCVRWSQLGAFYPFMRNHNDHDSVSQEPYVFSSEAQKAIKSALLI
RYTLLPYLYTLFHKAHSSGETVARALFIEFPTDPNTWTIDRQYLWGEALLITPVLEQGKT
TVNAYFPTGTWYAPESGTGIQSKGQWLMLPAPLDKINVHIRGGYILPAQVPGMNTEESRK
NKLLLVVALTPDGVARGDLFWDDGVSLGTFERQDYTHVVFLAANNILLNELIRVNSQADG
LKLGMVNVYGVPSPPKKVLINGIASEDYSYTLDTKVLIIKSLSLPIGQQFVITWTL
NT seq 2691 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgcagggctccatgggcagaaggagttctgcagattcagtatgcagtctgttg
atgctcattttgatttctgctgtatgtcctgtagccccatcacaagaaacagggcctagc
cctttgcagtgtagcgtgtcccccaacaggcgatttgactgtgttccagaaaagtgtgta
agtaaggaggagtgtgaggcgcgtggctgctgctactctccagcaggagataaagggaac
attggacagccttggtgcttttttcctccaagctatccgagttacaagatgtttaattta
acccagacagatagaggatacaatgccaccctcaagcgctcagtggggacattcatgcct
catgatataatgacattacagctggaagttttgtttgagacagagagtagacttcacttt
accataaaagatcctgctaaaaaacgctatgaggttccaataccaactccacaggtcagt
ggcaaggcatccagcacactcttcgatgtccaattttcctgtgacccttttggtttgatc
attcgcagaaagtccagcgggctgattttgttgaacaccactgtggcgccgctaatattt
gcagatcagttcttgcagatctcaacatcccttccctctgggtatctgtatggtctgggg
gaacaccttactgctcttaacctcagccttcaatggaatcgcctcactttctggaacaga
gatttacgaccttcaaaagattctaatttgtatgggtctcatccattctacctgtctatg
gaggaaggtggccaaagtcatggggtatttctgctaaacagcaatgctatggatgtattg
ctgcaggaagcccctgctctgacctggagaactacaggaggaatcctggatttttatgta
tttcttgggcctgagccaaaatcagtgatccgtcagtatcaggatattattgggtatcca
ttcatgcctccctactggagtcttggtttccacctttgccgctgggggtattcaacttca
aactgcactcgacaggtggtgaaaaatatgagggatgcaaagattccactggatgtgcag
tggaatgatattgattacatggatgccatgcgagattttacatatgatcagaacaggttt
ggggattttccagagatggtgaaggagttccaccaacagggagtcaaatacatcatgatc
ttggacccagcgatcagcagctccaacacacctgggagttacccaccatatgatgatggc
ctgaagagaggagtgtttatcactgatgatgaaggaaaaccccttgtagggaaggtctgg
cctggcctcactgtatttcctgattttacaatgccagagacatttagctggtggtatgat
atggtgaagcttttccatgaccaagtaccctttgatgggatttggattgatatgaatgag
ccctcaaattttgtccagggctcagtggatggatgccccaacaatgagctggagaaccct
ccctacgttcctggggtagttggaggctcacttcgttccaccaccatctgtgcttccagt
cagcagcatttatcctcacactacaaccttcacaatctgtatggactctctgaggcagtg
gccacccactatgctctggtaaaaattctgaaaaagcgtcccttcatcatttctcgctca
acatttgccagtcatggtcactatgctggtcactggaccggagatgtggtaagcagctgg
gaacagatttattactctgtaccagccattcttttgtttaacatgtttggtgtccccatg
gtgggagcagatatttgtggatttgggggtaacaccacagaggagctttgtgtgcgctgg
agccaactaggagccttttatccttttatgagaaaccataacgatcatgattcagtgtca
caggaaccatatgtattcagtagtgaggcacagaaagctataaagtcagccttgctcatc
cgctacacgctgcttccgtatctctacacccttttccataaggctcacagttctggggag
acggtggccagagctctttttattgagtttcccactgatccaaacacatggacaattgac
cggcagtatctttggggagaggctttattaatcacccctgttttggagcagggaaaaact
acagttaatgcatacttccctactggaacgtggtatgcccctgaatcgggcacaggaatt
caaagtaaaggccaatggcttatgcttcccgccccactagacaaaatcaatgttcacata
agaggaggttatattttgcctgcacaggtgcctggtatgaacacagaggagtctcgcaag
aacaaactgctgctagtggtggcactaacccctgatggggttgcccgtggtgacttgttc
tgggatgacggtgttagcttgggaacatttgagaggcaggactacactcatgttgtcttc
ctagctgcaaataatatcctgcttaacgagctaatccgtgtgaacagtcaggcagatggt
ttaaagctgggaatggtgaatgtttatggtgtacccagtccccctaaaaaggttctgata
aacggcattgcaagtgaagattactcttacaccttggatactaaggtgctgattataaag
agtctttctttgcctataggacaacagtttgtgatcacttggactttatag

DBGET integrated database retrieval system