KEGG   Xenopus tropicalis (western clawed frog): 100496006Help
Entry
100496006         CDS       T01011                                 

Gene name
slc39a2
Definition
(RefSeq) solute carrier family 39 (zinc transporter), member 2
  KO
K14709  solute carrier family 39 (zinc transporter), member 1/2/3
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100496006 (slc39a2)
Transporters [BR:xtr02000]
 Solute Carrier Family (SLC)
  SLC39: Metal ion transporter
   100496006 (slc39a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Zip
Motif
Other DBs
NCBI-GeneID: 100496006
NCBI-ProteinID: XP_002934324
Xenbase: XB-GENE-965557
LinkDB All DBs
Position
1
AA seq 306 aa AA seqDB search
MEQLMAVKVGCLVALLALTLIVGLIPPFFSWFLKSSVKGTYQLVICLISSFAAGTFLGAC
LLHVVAEALSSIATELSYIAYPMGELILSLGFFFVLFIERIVLQFCYHSQPQQLDGSPVP
ATQNSPEANSTEKQEHPEEINNAAEVSHNHIHVNLHSYSSFRSLILFLSLSVHSVFEGLA
IGLQSNYSSALQIAIAVLIHKGVIVFSLSLKLTQSKTRPLWLLVYVITLSLMSPIGITIG
IIVTLKKTTIITLVQAVLEGIASGTFVYVTFLEILPQELNTAEKPLLKLLFIALGFTAMA
VIAIWA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atggagcagctcatggcagtgaaagttgggtgccttgtggctcttctggccctcactttg
attgttggcttgatccctccatttttcagctggttcctgaagagcagtgttaaaggtacc
taccagctcgtcatttgcctaatcagttcctttgctgcaggcaccttcttgggggcttgt
ctgcttcacgtggtggcggaagccctctcatcaattgcaacagagctttcctatatcgcg
tatcccatgggagaattgatcctaagtttgggctttttttttgtcctgttcattgagcgt
attgtgctgcagttttgctatcattcccaaccccagcaattggatggaagccctgtacca
gccactcagaactctccagaggcaaactccacagaaaagcaggagcatccggaagagata
aataatgcagctgaggtttcgcacaatcacattcatgttaatcttcattcctattcatcc
ttccgctcactaatactctttctctctctttctgtccactctgtttttgaaggtttagcc
ataggacttcagtcaaactattccagtgctctgcagattgcaattgctgtgcttatacac
aagggtgtgattgtctttagtttgtcactaaaactaactcaaagcaagacccggccactt
tggttacttgtatatgtgataacactttccttgatgtctcccattggcattactattggc
attattgttacattaaaaaagaccactatcataactctagtacaggctgtcctagaaggc
attgcctctgggacctttgtctatgtcacctttctggagattctgccacaagaactcaac
actgcggaaaaaccacttctcaaacttctctttattgctcttggcttcacagctatggca
gttatagccatatgggcttaa

DBGET integrated database retrieval system