KEGG   Xenopus tropicalis (western clawed frog): 100496776Help
Entry
100496776         CDS       T01011                                 

Gene name
slc28a2, cnt2, slc28a1, spnt1
Definition
(RefSeq) solute carrier family 28 (concentrative nucleoside transporter), member 2
  KO
K11536  pyrimidine nucleoside transport protein
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    100496776 (slc28a2)
Transporters [BR:xtr02000]
 Solute Carrier Family (SLC)
  SLC28: Na+-coupled nucleoside transporter
   100496776 (slc28a2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Nucleos_tra2_C Nucleos_tra2_N Gate CcmD
Motif
Other DBs
NCBI-GeneID: 100496776
NCBI-ProteinID: XP_002934615
Xenbase: XB-GENE-965932
LinkDB All DBs
Position
3
AA seq 647 aa AA seqDB search
MEMNKVGVSNHAFSEDETASNDDYSVVIEAPPENPKTDVWSKVSKPFDASEKFIKKHRNI
LKYIVIGILCAGFAAYFIAACVLNFNRAVALVVITCVVLFFLGYDLVKKLYGKPIMRFLR
PVGSCLKKNKKWLKWVFCILVLAGLIAWLVIDTSKRPEQLISFGGVCMFILILFVLSKHH
RAVSWRAVFWGLGLEFVLGIFIIRTEPGYQAFKFVGEQIQIFLNYTTAGSGFVFGTALIQ
DVFAFQALPIVVFFSCVMSVLYYVGLMQYVILKISWLMQITMGTTATESLSVAGNIFVGQ
TEAPLLIRPYLPDMTKSEIHAVMTGGFGTIAGSVLGAYISFGIDASSLIAASVMAAPCAL
ALSKLVYPETEESKFKNEEGVIIEKGEERNVLEAASNGASASVGLVANIAANLIAFMALL
EFINAAFSWLGGMVNYPKLTLQLILSYIFMPIAFMMGVRWDEADKVGEMLGTKIILNEFV
AYRQLAEYKNLRLSGTEEWIDGQRQWISERAEVITTYALCGFANFSSIGIMLGGLSSMAT
ERKGDLAKVVLRALLTGACVSFVNACVAGILFSPRVIENCKDLLTSGNFINETSYTFYFC
CNNLYQSTQIDNGTLSFVDGWENLPNAILGAENCCMFYNNSVCDAWI
NT seq 1944 nt NT seq  +upstreamnt  +downstreamnt
atggaaatgaataaagttggagtttcaaatcatgcattttctgaggatgaaactgcatca
aatgacgattattcagtagtaattgaagcacccccagaaaacccaaaaacagatgtttgg
agtaaagtgtccaaaccatttgatgcatctgaaaaatttatcaaaaaacacagaaacatt
ctgaagtatattgttattgggatactctgtgcaggctttgctgcatactttatagcagca
tgtgttctgaatttcaaccgtgctgtggcattggtggtgataacatgtgtggtgcttttc
ttccttggttacgatctggtaaagaaattgtatgggaaacctataatgcggtttttgaga
cctgtcggaagttgcctgaaaaagaataagaaatggttgaagtgggtattctgcatattg
gttttagctggtcttattgcttggctggtcatagacacttccaaaaggccagaacagctt
atttcatttggaggagtctgtatgttcatcctcatcctctttgtcttatctaagcatcac
cgtgcggtatcttggagagcagtgttctgggggcttggacttgagtttgtcctaggaatt
ttcatcatccgtactgaacctggatatcaggcctttaagtttgttggtgaacaaattcag
attttcctgaattatacaactgctggctcaggatttgtgtttggaactgcacttatacag
gatgtgtttgcttttcaggctcttcctattgtggtcttcttcagctgtgtgatgtctgta
ctgtactatgttggcctcatgcagtatgttatccttaagatatcgtggctcatgcagatt
actatggggaccactgctacagaatcgttaagtgtagctggcaacatttttgttggacag
acagaagctccactgttaatccgcccttatttaccagacatgaccaaatcagaaatccat
gctgtgatgactgggggatttggtaccattgcaggcagtgtactgggtgcctatatttct
tttgggattgatgcatcttcactaattgctgcctctgtcatggctgctccctgtgccctt
gcactttctaagctggtttatcctgagactgaagaatcgaaattcaaaaatgaagaaggt
gtaataatagagaaaggagaagagcgaaatgtgcttgaagcagccagtaatggagcttct
gcatcagttggtttagtagccaacattgctgccaatttgattgcattcatggctctactt
gagtttattaatgcagcgttctcatggctgggaggaatggtgaactacccaaagctaaca
ctccagctaatcctgtcctacatatttatgccaattgccttcatgatgggagtaagatgg
gatgaggctgacaaggtgggcgagatgttggggaccaagataattttgaatgagtttgtg
gcctacaggcagttagcagaatacaagaatttgcgtttatcaggaactgaggaatggata
gatggacagaggcaatggatatcggaacgggcagaggttatcaccacatatgctctttgt
ggatttgccaattttagttctattggaattatgctaggagggttgtcttctatggcgact
gagcgcaagggtgaccttgccaaggtggttcttcgagccctgttaactggagcctgtgta
tcatttgtcaatgcatgtgtagcaggaattttatttagccctcgagtgattgaaaactgc
aaagatttattgaccagtggaaatttcattaatgagacaagctacactttttatttttgc
tgtaataatctttatcagagcactcaaatagataatggaacgctatcattcgttgatgga
tgggaaaacttgcctaatgctatcttgggtgccgaaaattgctgcatgttttataataac
tctgtgtgcgatgcctggatataa

DBGET integrated database retrieval system