KEGG   Xenopus tropicalis (western clawed frog): 100497480Help
Entry
100497480         CDS       T01011                                 

Gene name
ogdhl
Definition
(RefSeq) oxoglutarate dehydrogenase-like
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00020  Citrate cycle (TCA cycle)
xtr00310  Lysine degradation
xtr00380  Tryptophan metabolism
xtr01100  Metabolic pathways
xtr01200  Carbon metabolism
Module
xtr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xtr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xtr_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    100497480 (ogdhl)
  Amino acid metabolism
   00310 Lysine degradation
    100497480 (ogdhl)
   00380 Tryptophan metabolism
    100497480 (ogdhl)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     100497480 (ogdhl)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N
Motif
Other DBs
NCBI-GeneID: 100497480
NCBI-ProteinID: XP_002933951
Xenbase: XB-GENE-984152
UniProt: F6R5L4
LinkDB All DBs
Position
7
AA seq 1018 aa AA seqDB search
MSHLRTVAAKLKPYCTGLLVKHSSTPRTLPQRCSVYSSGAKEPFLSGTNSSYVEEMYYAW
LENPKSVHKSWDIFFQSADAGTPQCETRGVPSLTGIESKLQSLSSQGLATAPAKAEKIVE
EHLAVQSLIRAYQIRGHHVAQLDPLGILDADLDSFVPSDLITTLDKLGFYGLHEGDLDKV
FRLPTTTYIGGIDSTLSLREIIRRLENSYCQHIGLEFMFINDVEQCQWIRQKFETPGIMK
FTNEEKRTLLARLVRSTRFEDFLARKWSSEKRFGLEGCEVMIPALKVIIDKSSEMGLEYV
ILGMPHRGRLNVLANVIRKDLDQIFCQFDPKLEASDEGSGDVKYHLGMYHERINRATNKK
ITLSLVANPSHLEAADPVVQGKTKAEQFYRGDSHGNKVMSVLVHGDAAFAGQGVVYETFH
LSDLPSYTTNGTIHIVVNNQIGFTTDPRMARSSPYPTDVARVVNAPIFHVNADDPEAVMY
VCSVAAEWRNTFNKDVVVDLVCYRRSGHNEMDEPMFTQPLMYKQIHKQVPVLKKYADKMI
AEGMVSLQEFEEEIAKYDRICEEAYARSKDKKILNIKHWLDSPWPGFFTLDGEPKSMTCP
PTGIPEDLLSHIGNIASSVPVTDFKIHGGLSRILKSRLEMTKNRTVDWALAEYMAFGSLL
KEGIHVRLSGQDVERGTFSHRHHVLHDQEVDRKTCVPMNHLWPNQAPYTVCNSSLSEYGV
LGFELGFAMASPNALVLWEAQFGDFYNTAQCIIDQFISSGQAKWVRHNGIVLLLPHGMEG
MGPEHSSARPERFLQMSNDDSDAYPEFTNDFEVCQLYDCNWIVVNCSTPASYFHVLRRQI
LLPFRKPLIIFTPKSLLRHPEAKSSFDDMNTGTNFQRVIPENGAASHNPQAVKRVIFCTG
KIYYELVKERHNKGLDNQVAITRLEQLSPFPFDLVKQEAEKYATSELVWCQEEHKNMGYY
DYVKARFLTILNHARPVWYVGRDPAAAPATGNKNTHHVELKRFLDVAFNLQYFEGKPF
NT seq 3057 nt NT seq  +upstreamnt  +downstreamnt
atgagtcacctcaggacagttgctgctaaattaaaaccatactgtactggtttgctggtg
aaacacagctccacccccaggacattgccccaaagatgttctgtgtattcatcaggagcc
aaagaacctttcttaagtggaaccaattccagttatgtggaagaaatgtattacgcatgg
ctggagaatccaaaaagcgtccacaagtcctgggacatttttttccaaagtgctgatgct
ggaacccctcaatgtgaaacacggggtgtgccatcattgactggtatagagagtaaattg
cagtccctttctagtcaaggattggccacggcaccggccaaagcagagaagatagtggaa
gagcatctggctgtgcaatctttgatcagagcataccagatccgtggacatcatgtcgcg
caactggacccactaggaatcttagatgcagacttggactcatttgttccttctgatcta
atcacaactcttgacaagctaggcttttatgggttgcatgaaggagatttggacaaagtt
ttccgcttgccaacaaccacttacattggaggcatcgattctactctgtctctgcgagag
atcatcagaagattggagaattcatattgtcaacacattggtctggagttcatgttcata
aatgatgtagaacagtgccagtggattcgacaaaagtttgagactcctggcatcatgaag
tttacaaatgaagagaaacgaacacttctagcaagacttgtacggtccaccaggtttgaa
gacttcctggcacgcaaatggtcatctgaaaagagatttggcttggaagggtgtgaggtg
atgatcccagcgttgaaggtgattatagacaagtctagtgagatgggattggaatatgtc
atacttgggatgcctcacaggggcaggctgaatgtactggcaaatgtgattcggaaggat
ttagatcagatcttctgccagtttgaccctaagctggaggcttcggatgagggatcaggg
gatgtgaaatatcacttgggaatgtaccatgaacgcattaatcgtgccacaaacaagaaa
attaccctatctttggttgctaatccctcccatttggaggctgcagatcccgtggtacaa
ggtaaaacaaaggcagaacagttttatcgaggagacagtcacggaaataaggtaatgtca
gtactggttcatggtgatgctgcctttgctggacaaggtgttgtatatgaaactttccac
ctcagtgaccttccttcatataccaccaatggaacaatccatattgttgtcaataaccag
attggctttaccacggatcctcgaatggcacggtcttctccgtaccccacagatgtggcg
agggtggttaatgcacccatattccatgtaaatgcagatgaccctgaagctgtcatgtac
gtgtgcagtgtggctgctgagtggaggaataccttcaataaagatgtagttgtggatttg
gtctgttaccgtcgtagtgggcacaatgaaatggatgagcccatgttcactcagccattg
atgtataagcagattcacaagcaggttccagttcttaagaagtacgctgacaaaatgata
gctgaaggcatggtttctttgcaagagtttgaggaagagattgcaaagtatgatagaatt
tgtgaagaggcctatgctaggtccaaagataagaaaattctcaatataaagcactggttg
gactcaccatggccaggatttttcactttagatggtgaaccaaagagtatgacgtgtccc
ccaactggtattcctgaagacttgctctcccatattggtaatattgccagttcagtgcct
gtgacagatttcaaaattcatggaggactctctaggattctgaagagcagactggaaatg
acaaagaatcgtacagtggattgggcactggcagaatacatggcatttggatctttgctg
aaagaaggaatccatgtcagacttagtgggcaggatgtagaaagaggaacgtttagtcat
cgtcatcatgttctgcatgatcaggaggttgaccgtaagacttgcgttccaatgaatcat
ctttggccaaaccaagctccttacacagtgtgcaacagttccttgtctgaatatggcgta
cttggttttgagcttggctttgccatggcaagccccaatgctttagtgctttgggaagca
cagtttggggatttttataacacagctcagtgcataattgaccagtttatcagctctggg
caggctaaatgggtccgtcacaatggaatcgtgctactgctacctcatgggatggaagga
atggggcctgagcattcatcagccagacctgaaaggtttctgcagatgagcaatgacgac
tctgatgcttatcctgaatttacaaatgattttgaagtttgccagctttatgactgtaac
tggattgtggtgaactgttctactccagccagttattttcatgttcttagaagacaaatt
ctgctgcccttccgtaaacctctaattatttttacacctaaatcattgctgaggcatcca
gaagcaaaatctagctttgatgacatgaacacaggtacaaattttcagcgtgtgattcct
gaaaatggtgcagcatcccacaatcctcaggcggttaaaagggtcattttctgcaccggg
aaaatttattatgagctggtaaaagagagacacaacaaagggttggataaccaagtggct
atcactaggttggagcagctctcgccgtttccctttgatttggtgaagcaagaagctgag
aagtatgccacctcagaactggtttggtgccaagaagaacacaaaaatatgggatattat
gactacgttaaagcacgttttctcaccatcctaaaccatgcaaggcctgtttggtacgtt
ggtcgggacccagcagcagctccagccactggaaataagaacactcaccatgtagaactc
aagagatttctggatgttgcctttaatttgcaatattttgaaggaaaacccttctga

DBGET integrated database retrieval system