KEGG   Xenopus tropicalis (western clawed frog): 100497994
Entry
100497994         CDS       T01011                                 

Gene name
rassf1
Definition
(RefSeq) ras association domain-containing protein 1 isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
xtr  Xenopus tropicalis (western clawed frog)
SSDB
Motif
Pfam: Nore1-SARAH RA C1_1 C1_2
Other DBs
NCBI-GeneID: 100497994
NCBI-ProteinID: XP_017949163
Xenbase: XB-GENE-494691
LinkDB
Position
4
AA seq 369 aa
MWENGASYEIIELKDLKPRDGIDLTQSSRGGHRLERTNAVRIPPSRTPPILQRSLRRRIL
GGQGDILPPGKAGEGHYFQPTSNTQHTWCDLCGDFIWGIYRKSLRCVYCSFTCHYRCRAL
IRLDCSRGTDLESESDPSEETSWEKESNVDEKPEKQPQALSKAELEQKIKAYNSQIKSNL
FMSLNKDGSFTGFIKVQLKLVRPVSVPASKKPSCLQDRKGSGRSQPIKRRTSFYLPKDTS
KHLHLSSRTPASEVIQALLRKFTVLDNPRKFALFERTEQEGQVSLRKLTDEEEPLKLRLL
SGPCDKTLSFVLKENETGEVNWDAFSMPELQNFLRILQREEEEHMRQIVQRYTRCREKMQ
EALASRTPG
NT seq 1110 nt   +upstreamnt  +downstreamnt
atgtgggaaaatggggccagctatgagataatcgagctgaaggatctgaagccgagggat
ggcatcgatctgacgcaaagctcccgtggggggcaccgcctggagcgtaccaatgctgtc
aggatccctccaagcaggacaccccctattctgcagaggagcctgagaaggagaatactt
ggtgggcaaggtgacatactgccacctgggaaagcaggagagggacattatttccagccc
acatctaacactcagcacacttggtgtgacctctgcggggacttcatatggggcatctac
aggaaaagccttcgctgtgtgtactgcagtttcacctgtcactatcgatgccgcgctctc
atacgattagactgcagcagagggaccgatttagagagtgagagtgacccatctgaagag
acctcatgggagaaagaatcaaatgtggacgaaaagccagaaaagcagccgcaggccctg
agcaaggcagagctagaacagaaaataaaggcttataattctcagataaagagcaatctc
ttcatgagtctgaacaaggatggctcattcactggattcattaaagttcagctaaagctt
gtccggcccgtttctgtcccagcttccaagaagccttcgtgtttacaggatcggaaaggt
agcggccgctctcagccaatcaaacgcaggacctccttctaccttcccaaagatacttca
aagcacctgcatctgagctcaaggacgccggctagtgaggtcattcaggcactgctgcgg
aagttcactgtgctcgataaccccaggaaatttgctctgtttgagcggacagaacaggaa
gggcaagtgtccttgagaaagttaacggatgaagaggagccactgaagctgcgtcttctc
tcagggccatgtgataaaactctgagttttgtgcttaaggagaacgagacaggagaagtc
aattgggacgcattcagcatgccggagctgcagaatttcttacgcattttgcagcgtgag
gaagaagagcacatgcgtcagattgtgcagcgttacacccgttgccgggagaagatgcag
gaagcactggcatcccgcacccctggctga

DBGET integrated database retrieval system