KEGG   Xenopus tropicalis (western clawed frog): 101731146Help
Entry
101731146         CDS       T01011                                 

Gene name
mgst2, gst2, mgst-ii
Definition
(RefSeq) microsomal glutathione S-transferase 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00480  Glutathione metabolism
xtr00980  Metabolism of xenobiotics by cytochrome P450
xtr00982  Drug metabolism - cytochrome P450
xtr00983  Drug metabolism - other enzymes
Brite
KEGG Orthology (KO) [BR:xtr00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101731146 (mgst2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101731146 (mgst2)
   00982 Drug metabolism - cytochrome P450
    101731146 (mgst2)
   00983 Drug metabolism - other enzymes
    101731146 (mgst2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101731146 (mgst2)
Transporters [BR:xtr02000]
 Other Transporters
  Pores ion channels [TC:1]
   101731146 (mgst2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MAPEG
Motif
Other DBs
NCBI-GeneID: 101731146
NCBI-ProteinID: XP_004911179
Xenbase: XB-GENE-5777808
LinkDB All DBs
Position
1
AA seq 149 aa AA seqDB search
MSADIVLLATVSFISACQQAYFAKLVGKYRMKHKVNPPAVTGPPEFERAFRAQQNCVEFS
AIFLVDLWAAGWFFNQGLAAVFGLVYIYGRHLYFHGYVESAKGRLPGFSLCKLSLVCLLV
MASAGLSNSLLDKYCDINLISRLQRLIFG
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggatattgtcctcctcgctacggtgtctttcatttctgcctgccagcaagca
tactttgccaaactggtgggaaaatatcgaatgaaacataaggtcaatcctcctgcagtt
accggacctccagagtttgagagagcgttcagagcgcagcagaactgtgttgagttttct
gcaatatttttggtcgatctttgggctgctgggtggttttttaatcaaggattagcagca
gtgtttgggcttgtatacatttatggtcgccatttatactttcatggctatgtggaatca
gctaaaggaaggcttccagggttttcattatgcaaactgtccttggtctgcttactggtc
atggcttcagctgggctaagcaacagcctcctagacaagtactgtgacatcaacttgatc
agccgactgcagcgcctgatatttggatga

DBGET integrated database retrieval system