KEGG   Xenopus tropicalis (western clawed frog): 101731695Help
Entry
101731695         CDS       T01011                                 

Definition
(RefSeq) UDP-glucuronosyltransferase 1-1-like
  KO
K00699  glucuronosyltransferase [EC:2.4.1.17]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00040  Pentose and glucuronate interconversions
xtr00053  Ascorbate and aldarate metabolism
xtr00140  Steroid hormone biosynthesis
xtr00830  Retinol metabolism
xtr00860  Porphyrin and chlorophyll metabolism
xtr00980  Metabolism of xenobiotics by cytochrome P450
xtr00982  Drug metabolism - cytochrome P450
xtr00983  Drug metabolism - other enzymes
xtr01100  Metabolic pathways
Module
xtr_M00014  Glucuronate pathway (uronate pathway)
xtr_M00129  Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101731695
   00053 Ascorbate and aldarate metabolism
    101731695
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    101731695
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101731695
   00860 Porphyrin and chlorophyll metabolism
    101731695
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101731695
   00982 Drug metabolism - cytochrome P450
    101731695
   00983 Drug metabolism - other enzymes
    101731695
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:xtr01003]
    101731695
Enzymes [BR:xtr01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101731695
Glycosyltransferases [BR:xtr01003]
 Others
  Hydrophobic molecule
   101731695
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UDPGT
Motif
Other DBs
NCBI-GeneID: 101731695
NCBI-ProteinID: XP_012826113
LinkDB All DBs
Position
9
AA seq 303 aa AA seqDB search
MELLASSNAAVWLLFCLGALSVSEGGKLLVVPMDGSHWLSMSSVVERLAQNGHEIIVAKP
ENSIVKFDSNLYTLRNFSTPYSNQDIHEHLQQFVGSQFSGSSLIEVVLTARNSLMDVQHM
MINMCKSLLQNKQLIQNLQEEKFDAVLNDPMFFCGVILAEHLGIPSVHFLREVPCMYDYI
SAQCDSPLSYVPRHFTQNSDKMNFLQRVGNTLLRLAEPIFCGAAFRGWEHLASEFLQREV
TAIQLLSRTSVWLMRVDFVFDYPRPVMPNMVYIGGINCAGTKPLSWHPTFMWKQRDASTR
HWI
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atggagctgttggcatcttctaatgctgctgtttggctgctcttctgcctgggagctctc
tctgtgagtgagggggggaagcttctggtagtgcctatggatggcagccactggctcagt
atgagctcggtggtagagaggctggcacagaatgggcatgagattatagttgcaaagcca
gagaacagcatagtgaagtttgactctaatctttacaccttgaggaatttctccaccccc
tacagcaaccaagatatccatgaacacctgcagcagtttgttggctctcagttcagcggt
tcttctctcattgaggtggttctgacagctcgtaatagtttaatggatgttcaacatatg
atgatcaacatgtgtaaaagtttgttgcaaaacaagcaactcatccagaacctgcaggag
gagaagtttgatgcggtgcttaatgacccaatgtttttttgtggtgtaatccttgcagag
caccttgggatcccttctgttcattttctaagagaggttccttgtatgtatgattatata
agtgcacagtgtgacagccccctttcctatgtgcccaggcacttcacccagaactcagat
aagatgaactttttacagcgtgtggggaatacactgctcaggttggctgagcctattttt
tgtggggcagcatttcgagggtgggaacatctggcctccgaattcctacagagagaggtg
actgctatacagctgctcagcagaacctctgtctggctcatgagagttgattttgttttt
gattatccgagacccgtgatgcccaacatggtttatatagggggtatcaactgtgcaggg
acaaagccactttcttggcacccgacatttatgtggaaacagcgtgacgcctccaccaga
cactggatctaa

DBGET integrated database retrieval system