KEGG   Xenopus tropicalis (western clawed frog): 101731874Help
Entry
101731874         CDS       T01011                                 

Definition
(RefSeq) transmembrane protease serine 2-like
  KO
K09633  transmembrane protease serine 2 [EC:3.4.21.-]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xtr01002]
    101731874
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-  
     101731874
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   101731874
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin SRCR_2 DUF1986 SRCR Trypsin_2 MHC2-interact
Motif
Other DBs
NCBI-GeneID: 101731874
NCBI-ProteinID: XP_004912265
LinkDB All DBs
Position
2
AA seq 482 aa AA seqDB search
MAGRDYRWNSPPPYYENRGFQQDNINGFSRPVQPNLYEAFQPPRPHPSPVPHYIPQVSTI
HSVPAVNHTKSQSWCTPRRKKIACIATATTLVLALLIVGAVLCWYFVTMSCQRRCGTSGS
CVRSYEWCDGVAQCPGGEDESYCVRTYGPGFQLQAYIAAASAWLPVCSDNWGDTLGRRVC
QDMGYSTYVRSGSVGASDSAEGYLRLNTSVAEGKLQSRVYKSFVCTSGVVTLRCIECGSS
TKNVGNRIVGGSQASLGDWPWQVSLQFNERHICGGSIITPNYILTAAHCVEGVYSSPYPW
TVYVGSLYKSTGGTRYSVKSLIGHQNYDTKTKNNDIALMRLKSPITLTSTVQPVCLPNAG
MLWTSGQSCWTSGWGATIEGGTSSGVLNAAMVPLIDSDTCNRAVVYNGAVTATMICAGYL
RGGIDSCQGDSGGPLVTKTSSLWWLVGDTSWGTGCANMNKPGVYGNITELLPWIFLQMQT
NG
NT seq 1449 nt NT seq  +upstreamnt  +downstreamnt
atggctggcagagattatcgatggaactctccacccccatattatgaaaatcgtggtttc
cagcaggacaatattaatggcttcagtcgtccagtccaacccaatctgtatgaagccttt
cagccgcccagaccccatccctctccggtgccacattatatcccccaagtatccaccatt
cactccgtgccagccgttaatcacaccaagtcccaatcatggtgcaccccaagaagaaaa
aagattgcatgtattgccacggccaccactctagtcctagcgctgctgatcgttggcgcg
gtgctctgctggtatttcgtgacaatgagttgccagaggagatgtggtacaagcggaagc
tgtgtgcgctcctacgagtggtgtgatggggtcgcccagtgtcccgggggagaggatgaa
agctattgcgttcggacgtacgggcctggcttccagctccaagcctacattgcggctgct
tcggcctggctgccggtgtgcagtgacaactggggggacaccctggggagacgtgtgtgc
caggacatgggatacagcacttatgtcagaagcggatcagtgggtgcctcagacagcgcc
gagggatatctcaggctcaataccagtgtggccgaaggcaaactgcagagcagagtttac
aagagcttcgtctgtacatcgggagtggttacattgcgctgtatagaatgcggctcctct
accaagaatgtgggtaacaggatagtggggggctctcaggcctcactgggcgactggccc
tggcaagtgagtctgcagttcaacgagagacatatctgtggcggctctataattaccccc
aactatatactcaccgctgcacattgtgtggaaggagtttattcgtctccgtacccgtgg
acggtttatgttggatccctctacaaaagcaccggcgggacccgctattccgtgaaatct
ctgattggccaccagaattatgatacaaagacaaagaacaatgacatcgccctgatgagg
ctgaaaagccccataacccttacctctacagtccaacccgtgtgccttccaaacgcaggg
atgctctggacatccggacagtcatgttggacctctggatggggagccaccattgaagga
ggcacatcaagcggtgttttgaatgcggctatggttcccttgatcgactctgatacctgc
aacagagccgttgtgtacaatggcgcagtcactgccacaatgatatgtgcaggttacctg
agagggggcatagacagctgccagggggacagcggaggtcctttggtcaccaagactagc
tccctctggtggctggttggggacacaagctggggaactggttgcgccaacatgaacaag
cctggagtgtacgggaacatcacggagttgctgccatggatattcctacagatgcagacc
aacggataa

DBGET integrated database retrieval system