KEGG   Xenopus tropicalis (western clawed frog): 101732126
Entry
101732126         CDS       T01011                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04012  ErbB signaling pathway
xtr04068  FoxO signaling pathway
xtr04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101732126 (cdkn1b)
   04068 FoxO signaling pathway
    101732126 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101732126 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 101732126
NCBI-ProteinID: XP_031754513
LinkDB
Position
3
AA seq 150 aa
MSGVPLSPEAPGVERVSRAPSSPRSPARRCLFGPVDHELLARDLERSLRAMENEKSERWN
FDFRNHRPLPGPLHWEETEKAPEFYRRGQDSQSQWAEGQAEPRAKKRNGETADSSAPSMK
KSHRKEAEDTAGGSLTPPPEETPKKSKPGT
NT seq 453 nt   +upstreamnt  +downstreamnt
atgtcgggcgtgccgttatccccggaggccccgggagtggaacgggtgtcccgggccccc
agctcgccccgttcccccgcccggcgctgcctgttcggcccggtggatcatgagctgttg
gcccgggacctggagcgcagccttcgggcgatggagaacgagaaaagcgagaggtggaac
ttcgacttccgcaaccaccggccgctgccggggcccctccactgggaggaaacggagaag
gcgcccgaattctaccgcagggggcaggattcccaatcacagtgggccgagggccaggcg
gagcccagagccaagaagcgcaacggggagacggcggattcctctgccccctccatgaag
aagtcccacaggaaagaagctgaagacacagcaggtggcagcttaactcctccccccgag
gaaactcccaagaagagtaaacccggcacgtaa

DBGET integrated database retrieval system