KEGG   Xenopus tropicalis (western clawed frog): 394500Help
Entry
394500            CDS       T01011                                 

Gene name
vapb, vamp-b, vamp-c, vap-b, vap-c
Definition
(RefSeq) VAMP (vesicle-associated membrane protein)-associated protein B and C
  KO
K10707  vesicle-associated membrane protein-associated protein B
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:xtr04131]
    394500 (vapb)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    394500 (vapb)
Membrane trafficking [BR:xtr04131]
 Autophagy
  Other autophagy associated proteins
   ER-mitochondria tethering complex
    394500 (vapb)
Transporters [BR:xtr02000]
 Other Transporters
  Others
   394500 (vapb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Motile_Sperm YabA ZapB HALZ Com_YlbF EMC3_TMCO1 ASH ATP-synt_G FapA DUF4407
Motif
Other DBs
NCBI-GeneID: 394500
NCBI-ProteinID: NP_988905
Xenbase: XB-GENE-6258854
UniProt: Q6P7K7
LinkDB All DBs
Position
Un
AA seq 242 aa AA seqDB search
MAKVEQILQLEPQHELKFRGPFTDVVTTNLKLGNPTDKNVCFKVKTTAPRRYCVRPNSGV
IDAGSSINVSVMLQPFDYDPNEKSKHKFMVQSIMAPTDTSDMEAVWKEAKPDDLMDSKLR
CVFELPSENEKALDGEINKVISSSITKTESSLSKSISSNLDDSEYKKVVEENKRLQTEMQ
RLREEYKQFKEEDGLRMRKMQPTSSPNRPVSGLAKEEGVNTRILALVILFFIIGVIIGKV
AL
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggtggagcagatccttcagctggagccccagcatgagctcaagttccgagga
cccttcacagacgtcgtcactacaaacctgaagcttggcaaccccacagacaaaaatgtg
tgtttcaaagtgaagaccacggcgcctcgcaggtactgtgtgcgacccaacagcggggtg
atcgacgccggatcctccatcaatgtgtccgtgatgctacagccgttcgactacgacccc
aatgagaagagcaagcataagttcatggtgcagtcgatcatggcaccgacagacacctca
gatatggaggccgtatggaaagaagcaaagccagacgacctcatggattccaagctccgg
tgtgtgtttgagctgccgtcagagaatgaaaaagctctcgatggagagataaacaaagtc
atttctagcagtataacaaagactgagtcctctctgtccaaatcaataagctccaatctg
gatgattctgagtataagaaagtggtggaagaaaacaagaggctgcagacagaaatgcag
aggctacgggaggagtacaagcaatttaaggaagaagacggtttgagaatgcgaaagatg
cagcccacaagcagccccaaccgacccgtctccggcctcgcgaaagaagaaggagtgaac
actcggatacttgcactggtcatcctcttcttcattatcggcgtcattatagggaaagtg
gccttgtag

DBGET integrated database retrieval system