KEGG   Xenopus tropicalis (western clawed frog): 394645Help
Entry
394645            CDS       T01011                                 

Gene name
rrm2.1, rr2m, rrm2
Definition
(RefSeq) ribonucleotide reductase M2, gene 1
  KO
K10808  ribonucleoside-diphosphate reductase subunit M2 [EC:1.17.4.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00230  Purine metabolism
xtr00240  Pyrimidine metabolism
xtr00480  Glutathione metabolism
xtr00983  Drug metabolism - other enzymes
xtr01100  Metabolic pathways
xtr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    394645 (rrm2.1)
   00240 Pyrimidine metabolism
    394645 (rrm2.1)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    394645 (rrm2.1)
  09111 Xenobiotics biodegradation and metabolism
   00983 Drug metabolism - other enzymes
    394645 (rrm2.1)
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    394645 (rrm2.1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xtr03400]
    394645 (rrm2.1)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.4  With a disulfide as acceptor
    1.17.4.1  ribonucleoside-diphosphate reductase
     394645 (rrm2.1)
DNA repair and recombination proteins [BR:xtr03400]
 Eukaryotic type
  Other factors with a suspected DNA repair function
   Modulation of nucleotide pools
    394645 (rrm2.1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ribonuc_red_sm
Motif
Other DBs
NCBI-GeneID: 394645
NCBI-ProteinID: NP_989048
Xenbase: XB-GENE-947052
UniProt: Q6P876
LinkDB All DBs
Position
5
AA seq 378 aa AA seqDB search
MLSPRNALSPLKDNVSPMKRMALLDKENTPPGFNSGRTSRGTHKQWVCQSLKDPRIQDEP
LLRDNPGRFVILPIEYHDIWQMYKKAEASFWTAEEVDLSKDLPHWEALKPEERYFISYVL
AFFAASDGIVNENLVERFSQEVQVTEARCFYGFQIAMENIHSEMYSLLIDTYIKDPKERE
FLFNAIETLPCVKKKAEWALRWISDREAPFCERIVAFAAVEGIFFSGSFASIFWLKKRGL
MPGLTFSNELISRDEGLHTDFACLLFKHVVHKPSEQRVREIIIDAVKIEQEFLTEALPVE
LIGMNCKLMKQYIEFVADRLLLELGFKKIFKSENPFDFMENISLEGKTNFFEKKVAEYQK
MGVMSKATDKQFTLNAEF
NT seq 1137 nt NT seq  +upstreamnt  +downstreamnt
atgctgtctccgcgcaatgcgctcagtcctcttaaggataatgtgtcccccatgaagagg
atggcgctgctggataaagagaacacgccccccggcttcaactcgggcaggacctcccgg
ggaacacacaaacaatgggtttgtcaaagcttaaaagatcctagaatacaggatgagcct
ctcctcagggataacccagggcgctttgtgatcctacctattgagtatcatgatatttgg
cagatgtacaagaaggcggaggcttctttctggacagcagaagaggtggatctttctaaa
gatcttccgcactgggaagctctaaagcctgaggaaagatacttcatttcttatgtgttg
gccttttttgcagcaagtgatggcattgtgaatgagaatctggtggagcgcttcagccag
gaagtgcaagtaacagaggctcgctgcttttatggcttccaaattgcaatggagaatatt
cattctgagatgtacagccttcttatcgacacctacattaaagatcccaaggaaagggag
ttcctcttcaatgcaatagaaaccttaccctgtgtgaaaaagaaggcagaatgggccctg
cgttggataagcgacagagaagcacctttttgcgagcgcattgtggcctttgctgctgtt
gaagggatctttttctccggttcatttgcttccatattctggctgaagaaacgggggctg
atgcctggactcactttctctaatgaacttatcagcagagatgaaggtttacacactgac
tttgcttgccttctgtttaaacatgtcgtacacaaaccctctgagcagcgtgtcagggaa
attatcattgatgctgtcaagattgagcaggagttcttgactgaagctttgcccgtggag
ctaattggtatgaactgcaaactgatgaagcagtatattgaatttgtggcagatcgtctt
ctgctggagctaggttttaaaaagatttttaagagtgagaatccatttgattttatggag
aacatatccttggaaggaaagactaatttctttgagaagaaagttgccgaataccagaag
atgggtgtcatgtccaaggcaacagacaagcaattcactttaaatgccgaattttaa

DBGET integrated database retrieval system