KEGG   Xenopus tropicalis (western clawed frog): 394743Help
Entry
394743            CDS       T01011                                 

Gene name
samm50, cgi-51, omp85, sam50, samm50-a, samm50-b, tob55, trg-3
Definition
(RefSeq) SAMM50 sorting and assembly machinery component
  KO
K07277  outer membrane protein insertion porin family
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xtr03029]
    394743 (samm50)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    394743 (samm50)
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial protein import machinery
  Outer membrane
   TOB/SAM complex
    394743 (samm50)
Transporters [BR:xtr02000]
 Other Transporters
  Pores ion channels [TC:1]
   394743 (samm50)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Bac_surface_Ag POTRA
Motif
Other DBs
NCBI-GeneID: 394743
NCBI-ProteinID: NP_989138
Xenbase: XB-GENE-6456163
UniProt: Q6P806
LinkDB All DBs
Position
Un
AA seq 468 aa AA seqDB search
MGTVHARSLDPLPMNGPDFGSHDDADLVEVEPQKKQEILENKDVVVQRVHFEGLGRTKDD
LIAHEIGQVFKAKNLIEVMRKSHEAREKLLRLGVFRNVEVLIDTCEGEDALPNGLDVTFE
VTELRRLTGSYNTMVGNNEGSMVLGLKLPNLFGRAEKMTFQFSYGTKETSYGLSFFKPQV
GNFERNFSVNLYKVTGQFPWSSLRETDRGVSAEINFPIWKTSHTLKWEGVWRELGCLART
ASFAIREESGHTLKSSLSHTMVIDSRNTSILPKRGALLKINQELAGYTGGDVSFLKEDFE
LQLNKQLAWDSVLSTSLWGGMLVPIGDKPSSIADRFYLGGPTSVRGFSMYSIGPQSEGDY
LGGEAYWAGGMHLYTPLPFRPGRGGFGDLFRTHFFLNAGNLCNLNYGEGPRAHLRRLAEC
IRWSYGAGIVLRLGNIARLELNYCIPMGVQSGDRICDGVQFGAGIRFL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgggcaccgtacatgcccggagtctggatccccttcccatgaacggaccggacttcgga
tcccacgatgatgctgatctggtggaagtggaacctcagaagaaacaggagatactagag
aataaagatgtggtggtacagcgagtgcatttcgagggtctcggcaggacgaaagatgat
ctcatcgcgcatgaaatcggccaagtatttaaggccaaaaacctcattgaagttatgaga
aagtctcatgaggcccgagagaaactgctccgtctgggggtatttagaaatgtggaagtc
ttgatcgatacctgtgaaggggaagatgctttgcccaatggactggatgtgacgtttgag
gtgacagagttaaggagactcacaggcagttacaatactatggttgggaacaatgaaggc
agtatggttcttgggctgaaactccccaacctgttcggccgcgcagagaaaatgaccttc
caattttcctacggaaccaaggagacatcctacggcctgtccttctttaaaccccaagtc
gggaactttgaaagaaacttttctgtcaacttgtacaaagtaaccggccagtttccatgg
agctcactgcgcgagacggaccggggggtatcggccgaaatcaatttccccatctggaaa
accagccacaccctgaaatgggagggagtttggcgagagctcggctgtttggccagaacc
gcgtccttcgccattcgagaagagagcggccacaccctcaagtcttcattatcacacacg
atggtgatcgattctcgcaatacgtccatcctgccgaaacgaggcgccttattgaaaatc
aaccaggaactggccggatacacagggggggacgtcagctttctgaaggaagactttgag
ttgcagctgaacaagcagctcgcctgggactccgttctctcaacatctctatggggggga
atgctggtgcccatcggagacaagccgtccagtatcgcagaccggttttatctgggtgga
cccacaagtgtgcgaggattcagcatgtacagcatcggcccccagagcgaaggtgactat
ttgggcggggaagcttactgggccggggggatgcacttatacacccctctgcccttccga
ccgggtcgcgggggattcggggaccttttcagaacccacttcttcctcaacgccgggaac
ctgtgcaacctgaactacggggagggccccagggcccatctgcgccgattggccgaatgt
atccgctggtcctatggagcggggatagtcctgcgcctggggaatattgcacgactggaa
ctgaactattgtatccctatgggtgtccagagcggagacagaatctgcgacggggtgcag
ttcggcgcgggaatccgattcctttaa

DBGET integrated database retrieval system