KEGG   Xenopus tropicalis (western clawed frog): 394825Help
Entry
394825            CDS       T01011                                 

Gene name
pfkp, pfk, pfk-c, pfk1, pfkf
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00010  Glycolysis / Gluconeogenesis
xtr00030  Pentose phosphate pathway
xtr00051  Fructose and mannose metabolism
xtr00052  Galactose metabolism
xtr01100  Metabolic pathways
xtr01200  Carbon metabolism
xtr01230  Biosynthesis of amino acids
xtr03018  RNA degradation
Module
xtr_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    394825 (pfkp)
   00030 Pentose phosphate pathway
    394825 (pfkp)
   00051 Fructose and mannose metabolism
    394825 (pfkp)
   00052 Galactose metabolism
    394825 (pfkp)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    394825 (pfkp)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:xtr01009]
    394825 (pfkp)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:xtr03019]
    394825 (pfkp)
Enzymes [BR:xtr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     394825 (pfkp)
Protein phosphatases and associated proteins [BR:xtr01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     394825 (pfkp)
Messenger RNA biogenesis [BR:xtr03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     394825 (pfkp)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 394825
NCBI-ProteinID: NP_989217
Xenbase: XB-GENE-484391
UniProt: Q6P4Y8
LinkDB All DBs
Position
6
AA seq 802 aa AA seqDB search
MAQPDRKLFENLSGKGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVQAKVYFIYEGYQGMV
DGGDNIEEVSWESVSSILQVGGTVIGSARCKAFRTREGRLQAAYNLVQRGITNLCVIGGD
GSLTGANLFREEWSGLLDELMQNGKIEAEATREYAHLNIVGMVGSIDNDFCGTDMTIGTD
SALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGW
EDMMCNKLSENRARKKRLNIIIVSEGAIDCHNKAITSDMVKDLVVKRLGFDTRVTILGHV
QRGGTPSAFDRILASRMGVDCVLALLEATPETPACVVSLCGNQAVRLPLMECVQMTQEVQ
KAMDERRFDDAVRLRGRSFENNLNTYKLLSHKKNVADLPKSNFTVAVLNVGAPAAGMNAA
VRSAVRVGITEGHKMLAVNDGFEGFAKGQIKDIKWGDVGGWTGQGGSLLGTKRTLPAKYF
DKIAEQIRTHKINALLVIGGFEAYLGLMEMVEGRGKYDEFCIPMVMVPATVSNNVPGSDF
SIGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGGLAAGADAAYIFEE
SFDIRELQANVEHLTEKMKTSIQRGLVLRPRLFIDQPPIQTTPRLLRNENSNENYTTDFI
YQLYSEEGRGVFDCRKNVLGHMQQGGAPSPFDRNFGTKISAKAVQWISKKLKETYRKGRV
FANTDDSVCLLGMRRRNLLFQPVTQLKDETDFKHRIPKEQWWLKMRPLMKILAKYKTSYD
ISDAGKLEHVNMCRRKDETGPI
NT seq 2409 nt NT seq  +upstreamnt  +downstreamnt
atggcacagccagataggaagcttttcgagaatctgtccgggaagggcaaagccatcggg
gtgctgaccagcggaggagatgcccaaggtatgaacgcagctgtgcgcgccgtagtgcga
atgggcatctacgtacaagccaaagtgtacttcatttatgagggctaccaaggaatggtg
gatggcggagacaacattgaggaagtgtcatgggaaagcgtttctagcatcttgcaagtg
ggtgggaccgtcattggtagtgcgcgttgcaaggcattccggactcgcgaaggacgtttg
caggcagcttataaccttgttcaacgtggaattaccaatctgtgtgttattggcggtgat
ggcagtctgacaggtgctaacctgttccgtgaggaatggagcgggcttcttgatgaacta
atgcaaaatggaaaaattgaggcagaagcaaccagggaatatgcccatctgaacattgta
ggaatggtgggatctatagataatgatttctgtggaactgatatgaccattgggaccgac
tctgccctgcataggattattgaagtggttgatgctatcatgaccacagctcagagccac
cagaggacctttgtgctggaagttatgggaagacactgtgggtacctcgctctggtcagt
gccttagcttgtggggcagactgggtgtttatccctgaataccctccggaagagggatgg
gaagacatgatgtgcaacaaactgtctgagaatcgtgcaaggaagaaaaggcttaatatc
atcattgtatcagaaggagctatcgactgccataataaggcaatcacgtcagacatggtt
aaggatcttgttgtgaaacgcctggggtttgacacccgtgttacaatattgggccatgtc
caaagaggtggaaccccatcagcttttgacaggattctggcaagtcgaatgggagtggac
tgtgtgttggccctgcttgaagctacgccagaaacgccagcctgtgttgtgtcgttatgt
ggaaaccaagctgtgcgactgccccttatggaatgtgttcagatgacccaggaagtgcag
aaggccatggatgaaagaagatttgatgatgctgtaaggttacggggaaggagctttgaa
aataacctaaacacttacaagctgctctcccataagaaaaatgtagcagaccttccaaag
agtaatttcaccgtggccgttctgaatgtgggggcaccggctgcgggcatgaacgctgca
gtcagatctgcggtgagagtaggaataactgaaggccacaaaatgctagccgtcaatgat
ggttttgaaggattcgccaaggggcagattaaagacataaaatggggagatgttggtggc
tggactggtcaaggcggatctcttctgggaacaaagaggacccttcctgctaaatacttt
gacaaaattgcagagcaaatccgaacgcataaaattaacgctctccttgtcattggtgga
tttgaggcctacttgggactgatggaaatggttgagggccgagggaagtatgatgagttc
tgtatccctatggtcatggttcccgctactgtctccaacaatgtgcccggctcagatttc
agcattggtgcagatacagctctgaacactataaccgatacgtgcgatcgcatcaaacag
tcagcgagtggaaccaaacggcgggtcttcatcattgaaaccatgggtggctactgcggc
tacttggctaacatgggcggcctcgcggccggtgcagatgcggcgtacatctttgaagaa
tcctttgatattcgggagctccaggcaaatgtggaacatttaacagagaagatgaaaaca
agcatccaaagaggtctggtactgaggcctcgcctattcatagatcagcctcccattcaa
accactccccggttgttaagaaatgagaacagcaatgagaactacacgacagatttcatt
tatcagctttactcggaggaaggcagaggcgtgtttgactgcagaaagaatgtattgggc
cacatgcagcagggtggcgctccttccccgttcgacagaaacttcggcactaaaatttcc
gccaaagccgttcagtggatttccaagaagttaaaagaaacctacaggaaaggcagggta
ttcgccaacacggacgacagcgtttgcctgttaggaatgcgcaggaggaaccttcttttc
cagccagttacacaactcaaggacgaaacagacttcaagcacaggattcccaaggaacag
tggtggctgaagatgaggcctttgatgaagattctggccaagtacaagacaagctacgac
atttcagacgccgggaagctggaacacgtgaacatgtgcagacggaaagatgaaacggga
cccatctga

DBGET integrated database retrieval system