KEGG   Xenopus tropicalis (western clawed frog): 394912Help
Entry
394912            CDS       T01011                                 

Gene name
timm10, tim10, tim10a, timm10-a, timm10-b
Definition
(RefSeq) translocase of inner mitochondrial membrane 10 homolog
  KO
K17778  mitochondrial import inner membrane translocase subunit TIM10
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:xtr03029]
    394912 (timm10)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    394912 (timm10)
Mitochondrial biogenesis [BR:xtr03029]
 Mitochondrial protein import machinery
  Inter membrane space
   Transporter inner membrane (TIM) 9/10 complex
    394912 (timm10)
Transporters [BR:xtr02000]
 Other transporters
  Primary active transporters [TC:3]
   394912 (timm10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-Tim10_DDP
Motif
Other DBs
NCBI-GeneID: 394912
NCBI-ProteinID: NP_989294
Xenbase: XB-GENE-967786
UniProt: Q6P321
LinkDB All DBs
Position
1
AA seq 90 aa AA seqDB search
MDPLKAQQLAAELEVEMMADMYNRMTGACHKKCVPPHYKEAELSKGESVCLDRCVSKYLD
IHERMGKKLTELSLQDEELMRKMQQGVSST
NT seq 273 nt NT seq  +upstreamnt  +downstreamnt
atggatcctttaaaagcacagcagttggcagcagagttggaggtggaaatgatggctgat
atgtataacaggatgactggcgcgtgtcataaaaaatgtgttcctccacactacaaagag
gccgagctgtctaaaggggaaagtgtatgcctggatcgctgtgtttctaagtatctggac
atccatgagcgaatgggaaagaagcttactgagctgtctctgcaagatgaggagcttatg
aggaagatgcaacagggtgtgagttcgacatag

DBGET integrated database retrieval system