KEGG   Xenopus tropicalis (western clawed frog): 407869
Entry
407869            CDS       T01011                                 

Gene name
rela
Definition
(RefSeq) transcription factor p65
  KO
K04735  transcription factor p65
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04010  MAPK signaling pathway
xtr04137  Mitophagy - animal
xtr04210  Apoptosis
xtr04218  Cellular senescence
xtr04620  Toll-like receptor signaling pathway
xtr04621  NOD-like receptor signaling pathway
xtr04622  RIG-I-like receptor signaling pathway
xtr04623  Cytosolic DNA-sensing pathway
xtr04625  C-type lectin receptor signaling pathway
xtr04920  Adipocytokine signaling pathway
xtr05132  Salmonella infection
xtr05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    407869 (rela)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    407869 (rela)
  09143 Cell growth and death
   04210 Apoptosis
    407869 (rela)
   04218 Cellular senescence
    407869 (rela)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    407869 (rela)
   04621 NOD-like receptor signaling pathway
    407869 (rela)
   04622 RIG-I-like receptor signaling pathway
    407869 (rela)
   04623 Cytosolic DNA-sensing pathway
    407869 (rela)
   04625 C-type lectin receptor signaling pathway
    407869 (rela)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    407869 (rela)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    407869 (rela)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    407869 (rela)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:xtr03000]
    407869 (rela)
Transcription factors [BR:xtr03000]
 Eukaryotic type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    407869 (rela)
SSDB
Motif
Pfam: RHD_DNA_bind RHD_dimer
Other DBs
NCBI-GeneID: 407869
NCBI-ProteinID: NP_001001211
Xenbase: XB-GENE-946506
UniProt: Q6NVN7
LinkDB
Position
4
AA seq 533 aa
MEGFLPSLWTDMVSSTVMPSSHPHVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTK
THPTIKINHYQGSARIRISLVTKDSPHKPHPHELVGKDCKDGYYEAELSPDRSIHSFQNL
GIQCVKKREVEDAIAHRIRTNNNPFNVPPEELKSDYDLNTVCLCFQVFIPDRAAGQVVPL
PFVVSQPIYDNRAPNTAELKICRVNRNSGSCMGGDEIFLLCDKVQKDIEVLFVLGNWEAR
GIFSQADVHRQVAIVFRTPAFHDTKIRQSVKVQMQLRRPSDKEVSEPMEFQYLPDEVDPH
HIDEKRKRTLDSFKHYVKNPFAGGETRTPRRIAVPNRIVPTKSEPITASIRPSPSVPNPM
VPSLSFSMPVLKVDSVTSASTRLSTVNISDFSNLGFSSQPPPQSDPDRIESFLNYPSFSG
DANLDLVEMLPNDTESRCTSLSSIDNSDFSQLLSESQTSGTLSAGLQEPGTSQGTLMSYP
DSIARLMSNRPIEDDGEERIDSVLMNGVFDMQQGVESITSLLDLDLSSFMNIK
NT seq 1602 nt   +upstreamnt  +downstreamnt
atggagggatttcttccttccctatggacagacatggtttcaagcacagtcatgccttcc
tcccacccacatgtggaaattatagaacagccaaaacagcgagggatgcgatttcgttac
aagtgtgaaggccgctctgctggaagcattccaggtgaacgaagcactgacacaacaaaa
actcatcccactattaagataaaccattaccagggctcagcgcgtattcgaatatcccta
gttactaaggattctccacacaaacctcaccctcatgagttggtaggaaaggactgtaag
gatggatattatgaagctgaactttccccagatcgtagtattcacagcttccagaacctt
ggcattcagtgtgtgaaaaagagagaggtggaggatgccatcgcccatcgtattcggaca
aataataacccttttaatgtgcctcctgaggagctgaagagtgattacgacctcaacact
gtttgcctgtgcttccaagtcttcattcctgatcgagctgctggtcaggtggttccttta
ccatttgtggtatcccagcccatctatgacaacagagcccctaatactgctgaactgaag
atatgccgagtgaacagaaattctgggagttgcatgggaggagatgagatcttcttactt
tgtgataaagtacaaaaagatatcgaggtgctattcgttttgggcaactgggaagctcga
ggcatattttcacaagcagatgttcaccgccaggtagccattgtcttcagaacacctgct
ttccatgacacaaaaatacgtcagtctgtcaaagtgcaaatgcagctgaggcggccatca
gacaaggaagtcagtgagcctatggagtttcagtatcttccagatgaagttgacccccac
catattgatgaaaaacggaaaaggacccttgacagtttcaagcattatgtgaagaatcct
tttgcaggaggagagacacgaaccccacgcagaattgctgtgccaaatcgtatagtgcca
acaaagtcagagcctataacagcatccattagacccagcccttcagttccaaatccaatg
gtgccttctctttcattttccatgccagtattgaaggttgacagtgtgacttcagcttcg
actcgtctatccaccgttaacatcagcgacttcagcaatttaggattttcatcacagcct
ccccctcagtctgatcctgaccgcatagaatcctttttaaactacccctcattctcaggc
gatgcaaatctggatttagtagaaatgttgccaaatgacacagagagccgctgtaccagt
ttgagttctattgacaatagtgattttagccagcttcttagtgagtcacaaacatctggg
acactctcagcaggtttacaagagcctgggactagtcaaggtacactcatgtcctatccc
gattccatcgctcggcttatgagcaaccggcccattgaagatgatggtgaagaaagaatt
gacagtgtcctaatgaatggggtttttgatatgcagcagggagtagagtctataacctcc
ttattagaccttgacctctcttctttcatgaacattaaataa

DBGET integrated database retrieval system