KEGG   Xenopus tropicalis (western clawed frog): 448026Help
Entry
448026            CDS       T01011                                 

Gene name
idh2
Definition
(RefSeq) isocitrate dehydrogenase 2 (NADP+), mitochondrial
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00020  Citrate cycle (TCA cycle)
xtr00480  Glutathione metabolism
xtr01100  Metabolic pathways
xtr01200  Carbon metabolism
xtr01210  2-Oxocarboxylic acid metabolism
xtr01230  Biosynthesis of amino acids
xtr04146  Peroxisome
Module
xtr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xtr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    448026 (idh2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    448026 (idh2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    448026 (idh2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     448026 (idh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Iso_dh Rbx_binding
Motif
Other DBs
NCBI-GeneID: 448026
NCBI-ProteinID: NP_001004799
Xenbase: XB-GENE-976315
UniProt: Q6GLF0
LinkDB All DBs
Position
3
AA seq 455 aa AA seqDB search
MAGYLRAVSTICRASAAALGKNPGVLAPALSQQQLQQQRNYADKRIKVANPVVEMDGDEM
TRIIWEFIKEKLILSNVDVELKYFDLGLPYRDQTNDQVTIDSALATLKYNVAVKCATITP
DEARVEEFKLKKMWKSPNGTIRNILGGTVFRDPIICKNIPRLVPGWTQAITIGRHAHGDQ
YKATDFVVDQAGTFKLVFAPANGTATKEWEVFNFPAGGVGMGMYNTDESISGFAHSCFQY
SIQKKWPLYLSTKNTILKAYDGRFKDIFQDIFEKHYKPEFDKLKIWYEHRLIDDMVAQVL
KSTGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKTIEAEAAHGTVTRHYREH
QKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLINFSLTLEKVCVETVESGIMTKDLAGC
IHGGMSNVRLNEHYVNTTDFLDAIKNNLDKALGKN
NT seq 1368 nt NT seq  +upstreamnt  +downstreamnt
atggcaggctacctgcgagctgttagcactatctgcagagcatccgccgccgccttgggc
aagaaccctggcgtgctcgccccggccctcagccagcagcaactgcagcagcaacggaac
tatgctgacaagcgtatcaaggtggccaatccagttgtggagatggacggtgatgagatg
acccgtatcatctgggaatttataaaagagaagttgatcctgtcaaatgtagatgttgag
ctgaaatactttgatcttgggcttccgtatcgtgaccaaacaaatgaccaggtcaccata
gactctgcactggccactctgaaatacaatgttgctgtgaaatgtgccactattacacca
gatgaggcaagagttgaagaatttaagctgaaaaagatgtggaagagtcccaatggaacg
atcaggaacattttgggtggaacagtgttccgtgatccaattatttgcaagaatattcct
cgtttggtacctggatggacgcaagctattactattggcagacatgcccacggagaccag
tacaaagctacagattttgtggtcgatcaggctggaactttcaagttagtctttgctccg
gcaaatggaactgccacaaaggaatgggaagtgttcaactttcctgctggaggtgtcggc
atgggcatgtacaacacagatgagtccatctctgggtttgcacacagctgctttcagtat
tccatacagaaaaagtggcccttgtatttgagcacaaagaacactattttgaaggcttat
gatggcaggtttaaggacatcttccaggacatctttgagaagcattacaagccagaattt
gacaaactgaagatttggtatgaacacagattgattgatgacatggttgcacaggttctg
aaatctaccggaggcttcgtttgggcttgcaagaactatgatggagatgttcagtcagat
attcttgctcaaggctttggttcacttggtttaatgacctcggtcctggtttgcccagat
ggaaagactattgaagctgaagcagctcatggaacagtcactcgccattacagggagcat
caaaagggaaggccaacaagcactaaccctattgccagtatttttgcatggacaagaggc
ttggaacacagaggcaagctagatggaaaccaggacctaattaacttctctttaacactt
gaaaaggtctgtgtggagactgtagaaagtggcatcatgacaaaagacttggctggctgt
attcatggaggcatgagcaacgttcgtcttaatgaacattatgtgaacacgacagacttt
ttggatgcaattaagaacaacctcgacaaagctcttgggaagaattaa

DBGET integrated database retrieval system