KEGG   Xenopus tropicalis (western clawed frog): 448045
Entry
448045            CDS       T01011                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04068  FoxO signaling pathway
xtr04110  Cell cycle
xtr04115  p53 signaling pathway
xtr04218  Cellular senescence
xtr04310  Wnt signaling pathway
xtr04340  Hedgehog signaling pathway
xtr04371  Apelin signaling pathway
xtr04510  Focal adhesion
xtr04530  Tight junction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    448045 (ccnd1)
   04340 Hedgehog signaling pathway
    448045 (ccnd1)
   04371 Apelin signaling pathway
    448045 (ccnd1)
   04068 FoxO signaling pathway
    448045 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    448045 (ccnd1)
   04115 p53 signaling pathway
    448045 (ccnd1)
   04218 Cellular senescence
    448045 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    448045 (ccnd1)
   04530 Tight junction
    448045 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 448045
NCBI-ProteinID: NP_001005452
Xenbase: XB-GENE-6077306
UniProt: Q6GLD3
LinkDB
Position
4
AA seq 291 aa
MELLCCEVDTIRRAHLDRNLITDRVLQTMLKAEETCCPNVSYFKCVQKEILPHMRKIVAT
WMLEVCEEQKCEEEVFPLAMNYLDRFLSVKTLRKSQLQLLGATCMFLASKMKETIPLTAE
KLCIYTDNSIRPEELLLMELLILNKLKWDLASVTPHDFIEHFLNKMPLTEDTKQIIRKHA
QTFVALCATDIKFISNPPSMIAAGSVAAAVQGLNLGNADSVFSTQRLTLFLSQVIKCDPD
CLRACQEQIESLLESSLRQAQQQHNTSSDTKNMVEEADISCTPTDVRDVNI
NT seq 876 nt   +upstreamnt  +downstreamnt
atggagctgctgtgctgcgaggtggacaccatcaggcgggcccatctggacaggaacctc
atcaccgaccgggttctgcagaccatgctcaaagcagaggagacctgctgccccaacgtg
tcctatttcaagtgcgtccagaaggagatcctgccccacatgcgcaaaatagtggccacc
tggatgctggaggtctgtgaggagcagaagtgcgaagaagaagttttcccccttgctatg
aactatttggaccgattcctgtccgtgaagaccctcaggaagagccaattgcagttgctg
ggggccacttgtatgtttctggcttctaaaatgaaggaaacgatcccactgactgcagag
aaactttgcatttacacagacaattccatcaggccagaggagttactgctaatggaactg
ctgattctgaacaagttgaaatgggacttggcctctgtgaccccccatgactttattgaa
cattttctaaacaaaatgccactgactgaggataccaagcagatcatccgcaaacacgcc
cagacatttgttgccctctgcgctacagatataaagtttatctccaatccaccctccatg
atcgccgccggcagtgttgcagcagccgttcagggactaaatttgggaaacgccgacagt
gtcttctccactcagcgcctcacgctttttctatcacaggtcatcaaatgtgacccggac
tgtttacgggcatgtcaagaacagatcgagtctctcctagagtccagtttgcgccaagca
cagcagcaacacaacacgtcctcagacacaaaaaacatggtggaagaggcggacatctcc
tgcaccccgaccgacgtccgggacgtcaacatctga

DBGET integrated database retrieval system