KEGG   Xenopus tropicalis (western clawed frog): 448267Help
Entry
448267            CDS       T01011                                 

Gene name
aldh2, aldh-e2, aldhi, aldm
Definition
(RefSeq) aldehyde dehydrogenase 2 family (mitochondrial)
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00010  Glycolysis / Gluconeogenesis
xtr00053  Ascorbate and aldarate metabolism
xtr00071  Fatty acid degradation
xtr00280  Valine, leucine and isoleucine degradation
xtr00310  Lysine degradation
xtr00330  Arginine and proline metabolism
xtr00340  Histidine metabolism
xtr00380  Tryptophan metabolism
xtr00410  beta-Alanine metabolism
xtr00561  Glycerolipid metabolism
xtr00620  Pyruvate metabolism
xtr01100  Metabolic pathways
Module
xtr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    448267 (aldh2)
   00053 Ascorbate and aldarate metabolism
    448267 (aldh2)
   00620 Pyruvate metabolism
    448267 (aldh2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    448267 (aldh2)
   00561 Glycerolipid metabolism
    448267 (aldh2)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    448267 (aldh2)
   00310 Lysine degradation
    448267 (aldh2)
   00330 Arginine and proline metabolism
    448267 (aldh2)
   00340 Histidine metabolism
    448267 (aldh2)
   00380 Tryptophan metabolism
    448267 (aldh2)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    448267 (aldh2)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     448267 (aldh2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 448267
NCBI-ProteinID: NP_001004907
Xenbase: XB-GENE-490836
UniProt: Q6DJ49
LinkDB All DBs
Position
1
AA seq 521 aa AA seqDB search
MLRTALGSLCGRVARMPLGVQLCRYSVAIPTPNPKPDVHFNQLFINNEWHDAASKKTFPT
INPSTGEVICHVAEGDKADVDKAVKAAREAFRLGSPWRRMDASQRGVLLNRLADLIERDR
AILATLETLDNGKPYAISYAVDLDLVVKCLRYYAGWADKCHGKTIPIDGDYFTYTRHEPV
GVCGQIIPWNFPLLMLAWKFGPALATGNVIVMKVAEQTPLTALHVASLVKEAGFPPGVVN
IITGMGPTAGAAISSHMDVDKVAFTGSTEVGRLIQQAAGKSNLKKVTLELGGKSPNIIFS
DADLDWAVEQAHFALFFNQGQCCCAGSRTYVQEDIYNEFVERSIQRAKNRIVGNPFDFKT
EQGPQVDEEQFNKVLGYIKSGKKEGAKLLYGGNPAADRGYFIQPTVFGDVTDNMTIAREE
IFGPVMQILKFKSIEEVIDRANNSMYGLAAAVFTKDIDKAHYVSQSVRAGTVWINCYDVF
GAQAPFGGFKASGIGRELGEYGLEAYTEVKNITIKIPQKNS
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgctccggacagccttggggagcctctgcggtagggtggctcgtatgccactgggggta
cagctctgcaggtattccgttgcaatcccaactccaaaccccaagccagatgtgcacttc
aaccagctctttataaacaacgagtggcatgatgctgccagcaagaagaccttccccacc
atcaacccatccacaggagaagtgatatgccatgttgcagagggagacaaagctgatgtg
gacaaagcagttaaagctgcacgtgaggcattcagattgggatcaccatggagaagaatg
gatgcatctcaaagaggtgttctgctaaaccgcctggcagatcttattgagagagacaga
gctatattagcaactttggagaccttagacaatggaaaaccatatgcaatttcttatgcg
gtggacttggatcttgtagtaaagtgcctaagatattatgcaggctgggctgacaaatgt
catggaaaaacaatcccaatcgatggagattattttacctacaccagacatgaaccggtt
ggagtttgcggacagatcattccgtggaatttcccgctactgatgctggcgtggaaattt
ggacctgctctggccactggaaatgtgattgtcatgaaggtggctgagcagacccctctc
actgctctgcatgttgccagccttgtgaaagaggctggattcccaccgggtgttgtgaat
atcattactggaatgggtcccacagctggtgcagctatctcctctcacatggacgtggat
aaagtagcatttactggctctacagaggttggtcgtttaatccaacaagcagctgggaag
agcaatttgaaaaaagtgacgctggaacttggcggaaagagcccaaatattatcttttct
gatgctgatttggattgggctgtggagcaggcccactttgctctgttctttaaccagggc
cagtgctgctgtgctggctctcgcacctatgttcaggaagatatctacaatgagtttgtt
gagaggagcatacaaagagcaaagaataggattgtggggaacccctttgactttaaaaca
gaacaaggacctcaggtggatgaggagcagtttaataaagttctggggtatataaaatct
ggaaaaaaggaaggtgcaaaactcctctatggtggtaaccctgctgctgatcggggctat
tttatccagcccaccgtttttggggatgtgactgacaacatgaccattgctagagaagag
atttttggacctgtgatgcaaattctaaagtttaaatccattgaagaggtgattgaccga
gccaacaactcaatgtatggtttggcagctgctgtgttcacaaaggacattgataaggct
cactatgtgtctcagtcagtaagagctggaactgtctggattaactgctatgatgttttt
ggagctcaagccccctttggtggattcaaggcatcaggaataggaagagaacttggcgaa
tatggacttgaggcatatacagaagtgaagaatatcaccattaagattccccagaagaat
tcctaa

DBGET integrated database retrieval system