KEGG   Xenopus tropicalis (western clawed frog): 448640Help
Entry
448640            CDS       T01011                                 

Gene name
cygb, hgb, stap
Definition
(RefSeq) cytoglobin
  KO
K21894  cytoglobin
Organism
xtr  Xenopus tropicalis (western clawed frog)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    448640 (cygb)
Transporters [BR:xtr02000]
 Other Transporters
  Pores ion channels [TC:1]
   448640 (cygb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Globin DUF592
Motif
Other DBs
NCBI-GeneID: 448640
NCBI-ProteinID: NP_001006870
Xenbase: XB-GENE-987724
UniProt: Q6DEW1
LinkDB All DBs
Position
10
AA seq 179 aa AA seqDB search
MEKVQGENDMERWERLEEITESERGVIKETWARVYANCEDVGVSILIRFFVNFPSAKQHF
SQFKHMEDPLEMEGSVQLRKHARRVMGAVNSVVENLGDPEKITTVLSIVGKSHALKHKVD
PVYFKILTGVMLEVIAEEYAKDFTPDVQLAWNKLRSHLYSHVLSAYKEAGWTQYPSNSV
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggagaaagtccaaggggagaacgacatggagcgatgggagaggctggaggagataacg
gagagtgagcgcggtgtcatcaaggagacctgggcacgggtatatgccaactgcgaggac
gtcggagtctctatactgatcaggttctttgtcaacttcccctccgccaagcagcacttc
agccagtttaagcacatggaggaccctttggagatggaaggcagtgtgcagctgcgcaag
catgcccggcgggtgatgggtgctgtcaacagtgtggtggaaaaccttggcgaccccgag
aaaataactactgttctgtcgatcgttgggaagagccacgctctcaaacacaaagtggac
cctgtctactttaagatcctgactggggtaatgctggaggtcattgcagaagagtacgcc
aaagatttcacccccgacgtacagctagcttggaacaaacttcggagccacttatacagc
cacgtactgtctgcatacaaggaggcgggctggacacagtaccccagtaactctgtgtga

DBGET integrated database retrieval system