KEGG   Xenopus tropicalis (western clawed frog): 448662Help
Entry
448662            CDS       T01011                                 

Gene name
gsto2
Definition
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00480  Glutathione metabolism
xtr00980  Metabolism of xenobiotics by cytochrome P450
xtr00982  Drug metabolism - cytochrome P450
xtr00983  Drug metabolism - other enzymes
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    448662 (gsto2)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    448662 (gsto2)
   00982 Drug metabolism - cytochrome P450
    448662 (gsto2)
   00983 Drug metabolism - other enzymes
    448662 (gsto2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xtr02000]
    448662 (gsto2)
Enzymes [BR:xtr01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     448662 (gsto2)
Transporters [BR:xtr02000]
 Other Transporters
  Pores ion channels [TC:1]
   448662 (gsto2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_3 GST_C_2 GST_C Glutaredoxin GST_C_5
Motif
Other DBs
NCBI-GeneID: 448662
NCBI-ProteinID: NP_001005086
Xenbase: XB-GENE-967227
UniProt: Q6DET4
LinkDB All DBs
Position
7
AA seq 241 aa AA seqDB search
MTGSEKSLAKGSPAPGPVSEETIRVYSMRFCPYAQRARLVLAAKGIKHEVININLKNKPD
WFIEKSPFGLVPSLETSSGQVIYESPIVCDYLDEVYPGKKLTPVDPFQKAQQKMIVEHFS
KISTLFYKILLAKKNNEDVSGVKAEVQEKLVKLDEILAKQNGLFFGGSDVSMVDYMIWPW
FERLIIFDSKDCLNKTPHIDKWYQQMLQDPAVKATYIEPDLLLGFFKLYSQNDVEACDYG
L
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgaccggatcggagaagagtttggccaaaggcagcccagctccgggcccagtctctgaa
gaaacaattcgtgtgtacagcatgagattctgcccatatgctcagagggcaaggcttgtt
ttggctgccaaaggaatcaagcatgaagtaataaacatcaatttgaagaacaaaccagac
tggttcattgagaagagcccatttggccttgttccatctttggagactagcagtggtcag
gtgatctatgaatctccaatcgtttgtgattatctggatgaggtttaccctgggaagaag
ttgacccctgtagaccccttccagaaagcccaacaaaagatgatagtggaacatttttcc
aagatctcaacattgttctataaaatattgttagccaagaaaaataatgaagatgtatcg
ggtgtgaaagcagaggtccaggagaagttggttaaacttgatgagatcctggctaaacaa
aacggccttttctttggtggaagtgatgtttctatggttgactacatgatctggccatgg
tttgaacggctcatcattttcgattcaaaggattgtttgaataaaaccccacacattgat
aagtggtatcaacagatgctgcaggatccagcagtcaaggccacatatattgaaccagat
ctcctgttaggctttttcaagctatacagccagaatgatgtggaagcctgtgattatggt
ctctaa

DBGET integrated database retrieval system