KEGG   Xenopus tropicalis (western clawed frog): 493190
Entry
493190            CDS       T01011                                 

Gene name
lpar2
Definition
(RefSeq) lysophosphatidic acid receptor 2
  KO
K04291  lysophosphatidic acid receptor 2
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04080  Neuroactive ligand-receptor interaction
xtr04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    493190 (lpar2)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    493190 (lpar2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:xtr04030]
    493190 (lpar2)
G protein-coupled receptors [BR:xtr04030]
 Rhodopsin family
  Lipid
   Lysophosphatidic acid
    493190 (lpar2)
SSDB
Motif
Pfam: 7tm_1
Other DBs
NCBI-GeneID: 493190
NCBI-ProteinID: NP_001007475
Xenbase: XB-GENE-5791365
UniProt: Q68PF6
LinkDB
Position
3
AA seq 344 aa
MSQCFYNESIKFFYNNSGKELYDTWRTKDMLVVGLGLTVCVFVLLFNLLVIAAIIINRRF
HYPIYYLLGNLAAADLFAGVAYTYLMFHTGPNTSKLTIKTWLVRQSLLDTSLTASVANLL
AIAVERHQTIFTMQLHSKMSNQRVCILIACIWIIALLLGLIPSFGWSCICNISTCSRMAP
LYSRSYLIFWAVSNLVAFLIMMGVYMHIFIYVKRKMTRMSQHTSSQPKYRETMINLMKTV
FIILSAFVICWTPGQVVLLLDGLNCKSCNVLAVEKYFLLLAEINSVINPIVYSYRDNEMR
NTFKQILCFFCNRGSKYSPTSLKSTNTERRILSDNGHLMRECSL
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgagtcagtgcttttataatgagagcataaagttcttctacaacaatagcgggaaagaa
ctctatgacacatggaggaccaaagacatgctggtggtgggcttgggacttacagtgtgc
gtctttgtgttgttattcaacctgcttgtgatagcagccattatcatcaacagacgattc
cactatccaatctactatctcctggggaacctggctgcagccgatctgttcgccggggtt
gcttatacatacctcatgttccacacgggtccaaatacgtctaaactaacaataaagacc
tggctagttcgacagagtctgctggacactagtttgacagcatcggtggccaacttgctg
gccatagctgtggagaggcaccagacaatatttaccatgcagctccatagtaagatgtca
aaccagcgggtgtgcatcctcattgcctgcatttggattatagcgttgttgctgggcctg
atcccatcttttggttggagttgtatatgcaacataagtacttgttctagaatggctcct
ctttatagcaggagctacctgatcttttgggcagtatccaacttggtggcttttttaatc
atgatgggagtctacatgcatatctttatctacgtcaagaggaagatgacgaggatgtcc
cagcacacgtcgtcccaacccaagtatcgggagaccatgataaacctaatgaagactgtc
ttcattatcttaagtgcctttgtgatctgctggacccccggccaagtcgtcctcctcctt
gatggtttaaattgcaagagctgcaacgtgctggctgtcgagaagtacttcctgctcctg
gccgagatcaattccgtcatcaatcccattgtttactcttatcgggacaatgagatgaga
aacacctttaagcagattctttgcttcttctgcaacaggggttccaagtactcccctact
tccctgaaatcgaccaacacggagaggagaatcttgtccgacaatggacacttaatgaga
gaatgcagcctttag

DBGET integrated database retrieval system