KEGG   Xenopus tropicalis (western clawed frog): 496627Help
Entry
496627            CDS       T01011                                 

Gene name
prss2, try2, tryp2
Definition
(RefSeq) protease, serine 2
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    496627 (prss2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xtr01002]
    496627 (prss2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    496627 (prss2)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     496627 (prss2)
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   496627 (prss2)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   496627 (prss2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 496627
NCBI-ProteinID: NP_001011202
Xenbase: XB-GENE-6065254
UniProt: Q5M959
LinkDB All DBs
Position
Un
AA seq 243 aa AA seqDB search
MKLLLICVLLGAAAAFDDDKIIGGSTCARNSVPYIVSLNSGYHFCGGSLISNQWVVSAAH
CYKASVQVRLGEHNIALSEGTEQFINSAKVIRHPSYNSRTIDNDIMLIKLASPASLNSAV
NTVALPSSCAAAGTSCLVSGWGNLSTTTSNYPDLLQCLNAPILTTAQCSGAYPGQITNNM
FCAGFLEGGKDSCQGDSGGPVVCNGELQGVVSWGIGCAQRNYPGVYAKVCNYNSWIQSTI
AAN
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgaaacttctcctgatctgtgtgctcctgggagccgccgctgcctttgatgatgataag
atcataggaggctccacctgtgccaggaactctgtgccctacatcgtctccctgaactct
ggctaccatttctgtggggggtccctgatcagtaaccagtgggtcgtgtctgccgctcac
tgctacaaggcgagcgtccaggtcaggctgggggaacacaacatcgccctaagtgaggga
accgagcaattcatcaactctgccaaggtcatcaggcaccccagctacaactccaggacc
atagacaatgacatcatgttgatcaaacttgcctctcccgcctccctcaactcagccgtc
aacaccgtggctctgccttctagttgtgccgccgccggtaccagctgcctggtctctggc
tgggggaacctttccaccactacctccaattaccccgacctcctgcagtgcctgaatgcc
cccatcctgaccaccgcccagtgttcaggcgcctaccccgggcagatcaccaacaacatg
ttctgtgctggattcctggagggtggcaaggactcctgccagggtgactctggtggcccc
gttgtgtgtaatggggagctgcagggagtggtgtcctggggtatcggctgtgcccagagg
aactaccctggagtctacgccaaggtctgcaactacaactcctggatccagagcaccatt
gctgccaactaa

DBGET integrated database retrieval system