KEGG   Xenopus tropicalis (western clawed frog): 496861Help
Entry
496861            CDS       T01011                                 

Gene name
adh1, ADH7, adh-1
Definition
(RefSeq) alcohol dehydrogenase 1
  KO
K13951  alcohol dehydrogenase 1/7 [EC:1.1.1.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00010  Glycolysis / Gluconeogenesis
xtr00071  Fatty acid degradation
xtr00350  Tyrosine metabolism
xtr00830  Retinol metabolism
xtr00980  Metabolism of xenobiotics by cytochrome P450
xtr00982  Drug metabolism - cytochrome P450
xtr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    496861 (adh1)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    496861 (adh1)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    496861 (adh1)
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    496861 (adh1)
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    496861 (adh1)
   00982 Drug metabolism - cytochrome P450
    496861 (adh1)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     496861 (adh1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 UDPG_MGDP_dh_N
Motif
Other DBs
NCBI-GeneID: 496861
NCBI-ProteinID: NP_001011391
Xenbase: XB-GENE-482968
UniProt: Q5M7K9
LinkDB All DBs
Position
1
AA seq 376 aa AA seqDB search
MDTAGKIVKCKAAVAWEIGKPLTIEEIEVEVPKASEVRIKMVATGICRTDDHVLKGALKG
IDFPVILGHEGAGIIESVGEGVTGLKPGDKVIPLCIPQCGKCSSCLNPNTNCCLKTHLSE
SQNVMPDKTSRFLCKGKAAYHFLWTSTFSEYTVVPVDAVAKIDDRVPMDKACLFGCGFPT
GYGAVVNTAKVEPGSTCAVFGLGGIGLSAVIGCKSAGAAIIIAVDINSAKFDIAKVFGAT
ECINPLDYSKPIQEVITEMTNGGVHYSFECIGNTDTMKAALECCHMGYGTSVIIGEAPSA
AQISFDPILLFTGRTWKGSIFGGWKSKESVPRLVDEFMANKFNLDGLVSHTLPFDQINEG
FELLRSGNSIRTILMF
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atggacactgctgggaaaattgtaaaatgcaaagcggctgtagcctgggagattggaaaa
ccccttacaattgaagaaatagaggttgaagtaccaaaagccagtgaagttcgaatcaag
atggttgcaacaggaatctgtcgcaccgacgaccatgttttgaagggggctttaaaaggt
attgattttcctgtcattttgggccatgaaggagctggaataattgaaagcgttggagaa
ggtgtgactggacttaaaccaggagacaaagttattccactttgtatcccacagtgtgga
aagtgcagttcttgccttaatccaaataccaactgctgccttaaaactcatctcagtgag
tcacaaaatgtaatgcctgacaagacatctagatttttgtgcaaaggaaaagctgcttat
cactttttatggacaagcaccttctcggaatatactgtggttccagttgatgcagttgca
aaaattgatgacagagtacccatggataaggcctgcctttttggatgtggttttccaaca
ggatatggagctgttgtcaatactgctaaggtggagcccggttctacttgtgctgtgttt
gggttaggtggaattggcctttcagctgtaataggttgcaaatctgcaggagctgcaata
attatagctgttgatataaacagtgctaaattcgatatcgctaaggtgtttggggcaaca
gaatgtatcaatcctctggattattccaagccaatccaggaggtgattactgaaatgaca
aatggaggagtacattattcctttgaatgtattggaaacacagatacaatgaaagcggcc
ctggaatgctgtcacatgggatatggaaccagtgttattattggagaggctccatcagca
gcacaaatctcttttgatccaatattgctgtttacaggacgtacatggaaagggagcata
tttggaggttggaaaagcaaggaaagtgtccctcgactggttgatgaattcatggcaaat
aaatttaatcttgatggattggtgagccacactttgccttttgatcagataaatgagggg
tttgagcttttacgctctggtaacagcatccgcactatcctgatgttctga

DBGET integrated database retrieval system