KEGG   Xenopus tropicalis (western clawed frog): 548509Help
Entry
548509            CDS       T01011                                 

Gene name
prss1, trp1, try1, trypsin
Definition
(RefSeq) protease, serine, 1
  KO
K01312  trypsin [EC:3.4.21.4]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    548509 (prss1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:xtr01002]
    548509 (prss1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:xtr04147]
    548509 (prss1)
Enzymes [BR:xtr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.4  trypsin
     548509 (prss1)
Peptidases [BR:xtr01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   548509 (prss1)
Exosome [BR:xtr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   548509 (prss1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Trypsin Trypsin_2 DUF1986
Motif
Other DBs
NCBI-GeneID: 548509
NCBI-ProteinID: NP_001015792
Xenbase: XB-GENE-5776262
UniProt: Q5EBE2
LinkDB All DBs
Position
Un
AA seq 244 aa AA seqDB search
MKFLIVLVLLGAAVAFEDDDKIVGGFTCTKNAVPYQVSLNAGYHFCGGSLINSQWVVSAA
HCYKSRIQVRLGEHNIAVNEGTEQFIESQKVIKHPSYNSRNLDNDIMLIKLSTTARLSSN
IQSVPLPSACASAGTNCLISGWGNTLSSGTNYPDLLQCLNAPILTASECSNSYPGEITNN
MFCAGFLAGGKDSCQGDSGGPVVCNGQLQGVVSWGYGCAQRNYPGVYTKVCNYVSWIQNT
IAAN
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcctcatcgtcctggtcttgttgggagcagccgttgcctttgaagatgatgat
aagatcgtagggggtttcacctgcaccaagaacgccgttccttaccaagtgtccctgaat
gctggataccatttctgtggggggtccctgattaacagccaatgggtggtctctgccgct
cactgctacaaatctcgtatccaggtccgactcggggagcacaacattgctgtaaatgaa
gggacagaacaattcattgagtcccagaaagtcatcaagcacccgagctacaactcccgg
aacctggacaacgacattatgttgatcaaactttccaccaccgccagactcagctccaac
atccaatcggtgcctctgccctcggcctgcgcttctgccggcaccaactgcctgatctcc
ggctgggggaacaccctgagcagcggcaccaactaccccgacctcctgcagtgcctgaat
gcccccatcctgactgccagtgagtgcagtaactcctaccccggggagatcaccaacaac
atgttctgtgccggcttcttggctggtggcaaagactcttgtcagggtgactctggtggc
cccgttgtgtgcaatgggcaactgcagggagtggtgtcctggggctatggctgtgcccag
aggaactaccccggtgtctacaccaaggtctgcaactatgtgtcttggatccagaacacc
attgctgccaactaa

DBGET integrated database retrieval system