KEGG   Xenopus tropicalis (western clawed frog): 548743Help
Entry
548743            CDS       T01011                                 

Gene name
sdha
Definition
(RefSeq) succinate dehydrogenase complex subunit A, flavoprotein (Fp)
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
xtr  Xenopus tropicalis (western clawed frog)
Pathway
xtr00020  Citrate cycle (TCA cycle)
xtr00190  Oxidative phosphorylation
xtr01100  Metabolic pathways
xtr01200  Carbon metabolism
Module
xtr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
xtr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
xtr_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:xtr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    548743 (sdha)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    548743 (sdha)
Enzymes [BR:xtr01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     548743 (sdha)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 548743
NCBI-ProteinID: NP_001015989
Xenbase: XB-GENE-956942
UniProt: Q28ED0
LinkDB All DBs
Position
6
AA seq 665 aa AA seqDB search
MAFLNVASSRLLSKTLQLGGRVQNCTATCTAATRNFHFSVYGRKDTSAKLSDSISTQYPV
VDHDFDAVVVGAGGAGLRAAFGLSEAGFNTACITKLFPTRSHTVAAQGGINAALGNMEDD
DWRWHFYDTVKGSDWLGDQDAIHYMTEQAPASVIELENYGMPFSRTEQGKIYQRAFGGQS
LKFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMENGECRGVIAL
CMEDGSIHRFRAKNTVIATGGYGRTFFSCTSAHTCTGDGTAMVTRAGLPCQDLEFVQFHP
TGIYGAGCLITEGCRGEGGILINSEGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGC
GKDKDHVYLQLHHLPPSQLASRLPGISETAMIFAGVDVTKEPIPVLPTVHYNMGGIPTNY
KGQVITHVNGEDRVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALSIAESCKP
GEPVPSIKENAGEESVANLDKLRFTNGSTRTSELRINMQKTMQNHAAVFRTGSVLKEGCE
KLSAINSTMDDIKTFDRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDY
KVRIDEYDYSKPIQGQQKKSFSEHWRKHTLSYVDGKGKVSLEYRPVIDTTLNEDCVSVPP
AIRSY
NT seq 1998 nt NT seq  +upstreamnt  +downstreamnt
atggcgtttctaaacgttgcatcgtcgcggcttctcagcaaaacactgcagttaggcggt
agagtacagaattgcactgcaacttgtacagcagcaacacgtaactttcacttctcagta
tatggaagaaaggacacttcagcaaaactttctgattcgatctcaacacagtatcctgta
gttgatcatgactttgatgcagttgttgttggtgctggtggtgctggattacgggctgcg
tttggattgtctgaagctggcttcaatacagcttgcataactaagctatttcctaccaga
tctcacactgttgctgcacagggtggaattaatgctgcgctgggtaatatggaagatgat
gactggaggtggcacttctatgacacggttaagggttcagactggcttggtgatcaagat
gccatccattatatgactgagcaagcaccagcttctgtcattgagctggaaaattacgga
atgcctttcagcagaactgagcaggggaaaatctaccagcgtgcatttggaggtcagagt
cttaagtttggaaaaggaggacaggctcaccgttgttgctgtgtggcagacagaacaggc
cattccttgctgcacactctctatggaaggtctcttcggtatgataccagttattttgtg
gaatactttgccctagaccttttgatggaaaatggtgaatgccggggtgtgatagccctc
tgtatggaagatggatcaatacatcgcttcagggccaagaacaccgtgatagcgactggg
ggatacggacgtacatttttcagctgtacctctgctcatacctgcactggagatggtact
gcaatggttacaagagctgggcttccatgccaggatttagaatttgtgcagttccaccct
acaggaatctatggggcaggatgtttgataacagaaggttgtcgtggagaaggaggaatc
cttatcaacagtgaaggtgaaaggtttatggaaagatatgctcctgtagcaaaggatttg
gcttcgcgagatgtggtttcccgttctatgactatagaaattcgagaaggaagaggctgt
gggaaggacaaagaccatgtttatcttcagctccaccaccttccacccagtcagctggca
tcccgactcccaggaatttctgagacagcaatgatctttgcaggagttgatgtaacaaag
gaacccattcctgtcctgccaacagttcattataacatggggggtattcctaccaattat
aaagggcaggtgattacccatgtaaatggtgaagatagagtggtaccaggactttatgca
tgtggagaggctgcatctgcttcagtacatggagccaacagattgggtgcaaactcactt
ctggatctggtggtctttggtcgtgcatgtgctctaagcattgcagagtcgtgcaagcct
ggtgaaccagtgccatcaattaaggaaaatgcaggagaggaatctgttgcaaatctggac
aaattacgctttaccaatggaagcactaggacttcagaactcagaatcaacatgcagaag
actatgcagaatcatgcagcagttttccgaacaggttctgtgttgaaggaaggttgtgaa
aaactgagtgccatcaattctacaatggatgacatcaagacatttgacagaggcattgtt
tggaacactgatttagtggagacactagagctgcaaaatttaatgctatgtgcactgcaa
acaatttatggtgctgaggcacgcaaagagagtcgtggtgcccatgcaagagaagattac
aaggtaagaattgatgagtatgattattcaaagcccattcaaggtcagcagaagaaaagt
tttagcgagcactggaggaagcacacgctatcttatgttgatgggaaaggaaaggttagc
ttggaatacagacctgtcatcgatacaactttaaatgaagactgtgtgtctgttccaccg
gcaattcgttcttactaa

DBGET integrated database retrieval system